Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine receptor (H3)
LigandBDBM50017674
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_673
Citation Lovenberg TWRoland BLWilson SJJiang XPyati JHuvar AJackson MRErlander MG Cloning and functional expression of the human histamine H3 receptor. Mol Pharmacol 55:1101-7 (1999) [PubMed]
More Info.:Get all data from this article
 
Histamine receptor (H3)
Name:Histamine receptor (H3 and H4)
Synonyms:G-protein coupled receptor 97 | HH3R | HISTAMINE H3 | HRH3 | Histamine H3 Receptor | Histamine H3 receptor (H3) | Histamine H3L | Histamine receptor (H3 and H4)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:48691.47
Organism:Homo sapiens (Human)
Description:Binding assays were using CHO cells stably expressing hH3R receptors.
Residue:445
Sequence:
MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS
SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA
GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL
AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR
RAFTKLLCPQKLKIQPHSSLEHCWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50017674
n/a
NameBDBM50017674
Synonyms:(2-Benzhydryloxy-ethyl)-dimethyl-amine | 2-(benzhydryloxy)-N,N-dimethylethanamine | 2-(diphenylmethoxy)-N,N-dimethylethanamine | Antitussive | Beldin | Belix | Benadryl | Benylin | CHEMBL657 | DIMENHYDRINATE | DIPHENHYDRAMINE | Dibenil | Diphen | Hydramine | N-[2-(BENZHYDRYLOXY)ETHYL]-N,N-DIMETHYLAMINE | Silphen | US9138431, DIPHENHYDRAMINE (Benadryl) | US9333199, DIPHENHYDRAMINE (Benadryl)
TypeSmall organic molecule
Emp. Form.C17H21NO
Mol. Mass.255.3547
SMILESCN(C)CCOC(c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: