| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E2 receptor EP2 subtype |
|---|
| Ligand | BDBM22369 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | >10000±n/a nM |
|---|
| Comments | PDSP_4000 |
|---|
| Citation |  Chan, CC; Boyce, S; Brideau, C; Charleson, S; Cromlish, W; Ethier, D; Evans, J; Ford-Hutchinson, AW; Forrest, MJ; Gauthier, JY; Gordon, R; Gresser, M; Guay, J; Kargman, S; Kennedy, B; Leblanc, Y; Leger, S; Mancini, J; O'Neill, GP; Ouellet, M; Patrick, D; Percival, MD; Perrier, H; Prasit, P; Rodger, I Rofecoxib [Vioxx, MK-0966; 4-(4'-methylsulfonylphenyl)-3-phenyl-2-(5H)-furanone]: a potent and orally active cyclooxygenase-2 inhibitor. Pharmacological and biochemical profiles. J Pharmacol Exp Ther290:551-60 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Prostaglandin E2 receptor EP2 subtype |
|---|
| Name: | Prostaglandin E2 receptor EP2 subtype |
|---|
| Synonyms: | PE2R2_HUMAN | PGE receptor EP2 subtype | PTGER2 | Prostaglandin E2 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP4 subtype | Prostanoid EP2 Receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39775.71 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P43116 |
|---|
| Residue: | 358 |
|---|
| Sequence: | MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
|
|
|
|---|
| BDBM22369 |
|---|
| n/a |
|---|
| Name | BDBM22369 |
|---|
| Synonyms: | 4-(4-methanesulfonylphenyl)-3-phenyl-2,5-dihydrofuran-2-one | CHEMBL122 | MK 0966 | Rofecoxib | US11478464, Compound Rofecoxib | US11786535, Compound Rofecoxib |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H14O4S |
|---|
| Mol. Mass. | 314.356 |
|---|
| SMILES | CS(=O)(=O)c1ccc(cc1)C1=C(C(=O)OC1)c1ccccc1 |t:11| |
|---|
| Structure | 
|
|---|
Search and Browse
