Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E2 receptor EP3 subtype |
---|
Ligand | BDBM22369 |
---|
Substrate/Competitor | n/a |
---|
Ki | 41±n/a nM |
---|
Comments | PDSP_4000 |
---|
Citation | Chan, CC; Boyce, S; Brideau, C; Charleson, S; Cromlish, W; Ethier, D; Evans, J; Ford-Hutchinson, AW; Forrest, MJ; Gauthier, JY; Gordon, R; Gresser, M; Guay, J; Kargman, S; Kennedy, B; Leblanc, Y; Leger, S; Mancini, J; O'Neill, GP; Ouellet, M; Patrick, D; Percival, MD; Perrier, H; Prasit, P; Rodger, I Rofecoxib [Vioxx, MK-0966; 4-(4'-methylsulfonylphenyl)-3-phenyl-2-(5H)-furanone]: a potent and orally active cyclooxygenase-2 inhibitor. Pharmacological and biochemical profiles. J Pharmacol Exp Ther290:551-60 (1999) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
Prostaglandin E2 receptor EP3 subtype |
---|
Name: | Prostaglandin E2 receptor EP3 subtype |
Synonyms: | PE2R3_RAT | PTGER2 | Prostaglandin E2 | Prostaglandin E2 receptor EP3 subtype | Prostanoid EP3 receptor | Ptger3 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 39958.37 |
Organism: | RAT |
Description: | Prostaglandin E2 PTGER2 RAT::P34980 |
Residue: | 365 |
Sequence: | MAGVWAPEHSVEAHSNQSSAADGCGSVSVAFPITMMVTGFVGNALAMLLVVRSYRRRESK
RKKSFLLCIGWLALTDLVGQLLTSPVVILVYLSQRRWEQLDPSGRLCTFFGLTMTVFGLS
SLLVASAMAVERALAIRAPHWYASHMKTRATPVLLGVWLSVLAFALLPVLGVGRYSVQWP
GTWCFISTGPAGNETDSAREPGSVAFASAFACLGLLALVVTFACNLATIKALVSRCRAKA
AASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQMSVEQCKTQMGKEKE
CNSFLIAVRLASLNQILDPWVYLLLRKILLRKFCQIRDHTNYASSSTSLPCPGSSVLMWS
DQLER
|
|
|
BDBM22369 |
---|
n/a |
---|
Name | BDBM22369 |
Synonyms: | 4-(4-methanesulfonylphenyl)-3-phenyl-2,5-dihydrofuran-2-one | CHEMBL122 | MK 0966 | Rofecoxib | US11478464, Compound Rofecoxib | US11786535, Compound Rofecoxib |
Type | Small organic molecule |
Emp. Form. | C17H14O4S |
Mol. Mass. | 314.356 |
SMILES | CS(=O)(=O)c1ccc(cc1)C1=C(C(=O)OC1)c1ccccc1 |t:11| |
Structure |
|