Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 4
LigandBDBM85246
Substrate/Competitorn/a
Ki 0.57±n/a nM
CommentsPDSP_590
Citation Siehler SSeuwen KHoyer D Characterisation of human recombinant somatostatin receptors. 1. Radioligand binding studies. Naunyn Schmiedebergs Arch Pharmacol 360:488-99 (1999) [PubMed]  Article
More Info.:Get all data from this article
 
Somatostatin receptor type 4
Name:Somatostatin receptor type 4
Synonyms:SOMATOSTATIN SST4 | SS-4-R | SS4-R | SS4R | SST4R | Somatostatin receptor type 4 (SSTR4)
Type:Enzyme
Mol. Mass.:42015.38
Organism:Homo sapiens (Human)
Description:P31391
Residue:388
Sequence:
MSAPSTLPPGGEEGLGTAWPSAANASSAPAEAEEAVAGPGDARAAGMVAIQCIYALVCLV
GLVGNALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASSAALRHWPFGSVLCR
AVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLP
IAIFADTRPARGGQAVACNLQWPHPAWSAVFVVYTFLLGFLLPVLAIGLCYLLIVGKMRA
VALRAGWQQRRRSEKKITRLVLMVVVVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILS
YANSCANPILYGFLSDNFRRFFQRVLCLRCCLLEGAGGAEEEPLDYYATALKSKGGAGCM
CPPLPCQQEALQPEPGRKRIPLTRTTTF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85246
n/a
NameBDBM85246
Synonyms:CST17 | Cortistatin | Cortistatin-17 | L-Asp-L-Arg-L-Met-L-Pro-L-Cys(1)-L-Arg-L-Asn-L-Phe-L-Phe-L-Trp-L-Lys-L-Thr-L-Phe-L-Ser-L-Ser-L-Cys(1)-L-Lys-OH
TypeSmall organic molecule
Emp. Form.C96H139N27O24S3
Mol. Mass.2151.492
SMILESCSCC[C@H](NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@@H](N)CC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCN=C(N)N)NC1=O)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(O)=O |wU:67.141,135.143,56.57,71.73,50.51,44.45,94.98,105.110,141.147,116.122,124.130,8.15,19.19,wD:80.82,40.144,35.35,31.32,4.4,(40.86,-1.58,;39.4,-1.1,;38.25,-2.13,;36.79,-1.65,;35.64,-2.68,;35.97,-4.19,;37.43,-4.67,;38.57,-3.64,;37.75,-6.17,;36.61,-7.2,;36.93,-8.71,;35.78,-9.74,;36.1,-11.25,;34.96,-12.28,;35.28,-13.78,;33.49,-11.8,;39.21,-6.65,;39.53,-8.16,;38.39,-9.19,;41,-8.63,;42.14,-7.6,;41.32,-10.14,;42.78,-10.61,;43.1,-12.12,;43.93,-9.58,;34.18,-2.21,;33.04,-3.24,;33.86,-.7,;34.89,.44,;34.12,1.78,;32.61,1.46,;32.45,-.08,;31.12,-.85,;31.12,-2.39,;29.79,-.08,;28.45,-.85,;27.12,-.08,;27.12,1.46,;25.79,2.23,;25.79,3.77,;24.45,4.54,;23.12,3.77,;23.12,2.23,;24.45,1.46,;21.78,1.46,;20.45,2.23,;20.45,3.77,;21.78,-.08,;20.45,-.85,;20.45,-2.39,;19.12,-.08,;19.12,1.46,;17.78,2.23,;17.78,-.85,;17.78,-2.39,;19.12,-3.16,;16.45,-3.16,;15.12,-2.39,;15.12,-.85,;16.45,-.08,;16.45,1.46,;15.12,2.23,;13.78,1.46,;13.78,-.08,;16.45,-4.7,;15.12,-5.47,;13.78,-6.24,;13.78,-4.7,;12.45,-5.47,;11.11,-4.7,;11.11,-3.16,;9.78,-5.47,;8.33,-4.94,;6.89,-5.47,;5.71,-4.48,;4.26,-5,;3.08,-4.01,;9.78,-7.01,;11.11,-7.78,;11.11,-9.32,;12.45,-7.01,;11.92,-5.56,;10.4,-5.29,;9.3,-6.36,;7.95,-5.64,;8.21,-4.13,;7.26,-2.92,;7.83,-1.49,;9.36,-1.27,;10.31,-2.49,;9.74,-3.92,;13.78,-7.78,;15.12,-7.01,;16.45,-6.24,;16.45,-7.78,;16.45,-9.32,;15.12,-10.09,;13.78,-9.32,;12.45,-10.09,;12.45,-11.63,;13.78,-12.4,;15.12,-11.63,;17.78,-7.01,;19.12,-7.78,;19.12,-9.32,;20.45,-7.01,;21.78,-7.78,;21.78,-9.32,;20.45,-10.09,;20.45,-11.63,;21.78,-12.4,;23.12,-11.63,;23.12,-10.09,;20.45,-5.47,;21.78,-4.7,;21.78,-3.16,;23.12,-5.47,;23.12,-7.01,;24.45,-7.78,;24.45,-9.32,;25.97,-8.04,;24.45,-4.7,;25.79,-5.47,;26.77,-6.65,;27.12,-4.7,;28.45,-5.47,;28.45,-7.01,;29.79,-7.78,;29.79,-9.32,;31.12,-10.09,;31.12,-11.63,;32.45,-9.32,;27.12,-3.16,;28.45,-2.39,;29.79,-3.16,;13.78,-3.16,;13.78,-1.62,;12.45,-2.39,;24.45,6.08,;23.12,6.85,;25.79,6.85,;25.79,8.39,;24.45,9.16,;24.45,10.7,;23.12,11.47,;23.12,13.01,;21.78,13.78,;27.12,9.16,;27.12,10.7,;28.45,8.39,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: