Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E2 receptor EP1 subtype |
---|
Ligand | BDBM85184 |
---|
Substrate/Competitor | n/a |
---|
Ki | 1217±n/a nM |
---|
Comments | PDSP_257 |
---|
Citation | Abramovitz, M; Adam, M; Boie, Y; Carrière, M; Denis, D; Godbout, C; Lamontagne, S; Rochette, C; Sawyer, N; Tremblay, NM; Belley, M; Gallant, M; Dufresne, C; Gareau, Y; Ruel, R; Juteau, H; Labelle, M; Ouimet, N; Metters, KM The utilization of recombinant prostanoid receptors to determine the affinities and selectivities of prostaglandins and related analogs. Biochim Biophys Acta1483:285-93 (2000) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Prostaglandin E2 receptor EP1 subtype |
---|
Name: | Prostaglandin E2 receptor EP1 subtype |
Synonyms: | PE2R1_HUMAN | PGE receptor, EP1 subtype | PTGER1 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP1 subtype | Prostaglandin E2 receptor EP1 subtype (EP1) | Prostanoid EP1 receptor |
Type: | Enzyme |
Mol. Mass.: | 41834.57 |
Organism: | Homo sapiens (Human) |
Description: | P34995 |
Residue: | 402 |
Sequence: | MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQA
AGRLRRRRSAATFLLFVASLLATDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMVFF
GLCPLLLGCGMAVERCVGVTRPLLHAARVSVARARLALAAVAAVALAVALLPLARVGRYE
LQYPGTWCFIGLGPPGGWRQALLAGLFASLGLVALLAALVCNTLSGLALLRARWRRRSRR
PPPASGPDSRRRWGAHGPRSASASSASSIASASTFFGGSRSSGSARRARAHDVEMVGQLV
GIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLR
QLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF
|
|
|
BDBM85184 |
---|
n/a |
---|
Name | BDBM85184 |
Synonyms: | AH-6809 | CAS_33458-93-4 | NSC_119461 |
Type | Small organic molecule |
Emp. Form. | C17H14O5 |
Mol. Mass. | 298.2901 |
SMILES | CC(C)Oc1ccc2c(c1)oc1ccc(cc1c2=O)C(O)=O |
Structure |
|