Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E2 receptor EP1 subtype (EP1)
LigandBDBM50109546
Substrate/Competitorn/a
Ki 23±n/a nM
CommentsPDSP_468
Citation Abramovitz MAdam MBoie YCarrière MDenis DGodbout CLamontagne SRochette CSawyer NTremblay NMBelley MGallant MDufresne CGareau YRuel RJuteau HLabelle MOuimet NMetters KM The utilization of recombinant prostanoid receptors to determine the affinities and selectivities of prostaglandins and related analogs. Biochim Biophys Acta 1483:285-93 (2000) [PubMed]  Article
More Info.:Get all data from this article
 
Prostaglandin E2 receptor EP1 subtype (EP1)
Name:Prostaglandin E2 receptor
Synonyms:PGE receptor, EP1 subtype | Prostaglandin E2 receptor EP1 subtype | Prostanoid EP1 receptor
Type:Enzyme
Mol. Mass.:41834.57
Organism:Homo sapiens (Human)
Description:P34995
Residue:402
Sequence:
MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQA
AGRLRRRRSAATFLLFVASLLATDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMVFF
GLCPLLLGCGMAVERCVGVTRPLLHAARVSVARARLALAAVAAVALAVALLPLARVGRYE
LQYPGTWCFIGLGPPGGWRQALLAGLFASLGLVALLAALVCNTLSGLALLRARWRRRSRR
PPPASGPDSRRRWGAHGPRSASASSASSIASASTFFGGSRSSGSARRARAHDVEMVGQLV
GIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLR
QLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50109546
n/a
NameBDBM50109546
Synonyms:5-[(3aS,4R,5R,6aS)-5-Hydroxy-4-((S)-3-hydroxy-oct-1-enyl)-hexahydro-pentalen-(2Z)-ylidene]-pentanoic acid | 5-[5-Hydroxy-4-(3-hydroxy-oct-1-enyl)-hexahydro-pentalen-2-ylidene]-pentanoic acidCarbacyclin | CARBACYCLIN | CHEMBL148319 | PGI2
TypeSmall organic molecule
Emp. Form.C21H34O4
Mol. Mass.350.4923
SMILESCCCCC[C@H](O)\C=C\[C@H]1[C@H](O)C[C@@H]2C\C(C[C@H]12)=C\CCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: