Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E2 receptor
LigandBDBM85179
Substrate/Competitorn/a
Ki 255±n/a nM
CommentsPDSP_518
Citation Abramovitz MAdam MBoie YCarrière MDenis DGodbout CLamontagne SRochette CSawyer NTremblay NMBelley MGallant MDufresne CGareau YRuel RJuteau HLabelle MOuimet NMetters KM The utilization of recombinant prostanoid receptors to determine the affinities and selectivities of prostaglandins and related analogs. Biochim Biophys Acta 1483:285-93 (2000) [PubMed]  Article
More Info.:Get all data from this article
 
Prostaglandin E2 receptor
Name:Prostaglandin E2 receptor
Synonyms:PGE receptor, EP3 subtype | PGE2-R | Prostaglandin E2 receptor EP3 subtype | Prostaglandin E2 receptor EP3 subtype (EP3) | Prostaglandin E2 receptor EP3A subtype (EP3A) | Prostaglandin E2 receptor EP3D subtype (EP3D) | Prostanoid EP3 receptor
Type:Enzyme
Mol. Mass.:43335.03
Organism:Homo sapiens (Human)
Description:P43115
Residue:390
Sequence:
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI
RYHTNNYASSSTSLPCQCSSTLMWSDHLER
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85179
n/a
NameBDBM85179
Synonyms:CAS_94079-80-8 | CICAPROST | NSC_72023
TypeSmall organic molecule
Emp. Form.C22H30O5
Mol. Mass.374.4706
SMILESCCC#CCC(C)C(O)C#CC1C(O)CC2CC(CC12)=CCOCC(O)=O |w:20.22|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: