| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 4 |
|---|
| Ligand | BDBM94630 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 630.95±n/a nM |
|---|
| Comments | PDSP_1253 |
|---|
| Citation |  Bender, E; Pindon, A; van Oers, I; Zhang, YB; Gommeren, W; Verhasselt, P; Jurzak, M; Leysen, J; Luyten, W Structure of the human serotonin 5-HT4 receptor gene and cloning of a novel 5-HT4 splice variant. J Neurochem74:478-89 (2000) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| 5-hydroxytryptamine receptor 4 |
|---|
| Name: | 5-hydroxytryptamine receptor 4 |
|---|
| Synonyms: | 5-HT-4 | 5-HT4 | 5-HT4S | 5-HT4a | 5-HT4b | 5-HT4c | 5-HT4d | 5-HT4hb | 5-hydroxytryptamine receptor 4 | 5-hydroxytryptamine receptor 4 (5-HT4) | 5HT4R_HUMAN | HTR4 | Serotonin (5-HT) receptor | Serotonin (5-HT3) receptor | Serotonin 4 (5-HT4) receptor | Serotonin Receptor 4 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 43767.54 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q13639 |
|---|
| Residue: | 388 |
|---|
| Sequence: | MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP
QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESQCHPPATSPLVAAQPSDT
|
|
|
|---|
| BDBM94630 |
|---|
| n/a |
|---|
| Name | BDBM94630 |
|---|
| Synonyms: | 4-Amino-5-chloro-2-ethoxy-N-[4-(4-fluoro-benzyl)-morpholin-2-ylmethyl]-benzamide; citrate(AS-4370) | 4-amino-5-chloro-2-ethoxy-N-[[4-(4-fluorobenzyl)morpholin-2-yl]methyl]benzamide;citric acid | 4-amino-5-chloro-2-ethoxy-N-[[4-[(4-fluorophenyl)methyl]-2-morpholinyl]methyl]benzamide;2-hydroxypropane-1,2,3-tricarboxylic acid | 4-amino-5-chloro-2-ethoxy-N-[[4-[(4-fluorophenyl)methyl]morpholin-2-yl]methyl]benzamide;2-hydroxypropane-1,2,3-tricarboxylic acid | 4-azanyl-5-chloranyl-2-ethoxy-N-[[4-[(4-fluorophenyl)methyl]morpholin-2-yl]methyl]benzamide;2-oxidanylpropane-1,2,3-tricarboxylic acid | CHEMBL60889 | MLS001401439 | MOSAPRIDE CITRATE | Mosapride | SMR000469200 | cid_119583 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H25ClFN3O3 |
|---|
| Mol. Mass. | 421.893 |
|---|
| SMILES | CCOc1cc(N)c(Cl)cc1C(=O)NCC1CN(Cc2ccc(F)cc2)CCO1 |
|---|
| Structure | 
|
|---|
Search and Browse
