Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-Hydroxytryptamine receptor 7 (5-HT7)
LigandBDBM50130279
Substrate/Competitorn/a
Ki 3.16±n/a nM
CommentsPDSP_3796
Citation Lovell PJBromidge SMDabbs SDuckworth DMForbes ITJennings AJKing FDMiddlemiss DNRahman SKSaunders DVCollin LLHagan JJRiley GJThomas DR A novel, potent, and selective 5-HT(7) antagonist: (R)-3-(2-(2-(4-methylpiperidin-1-yl)ethyl)pyrrolidine-1-sulfonyl) phen ol (SB-269970). J Med Chem 43:342-5 (2000) [PubMed]
More Info.:Get all data from this article
 
5-Hydroxytryptamine receptor 7 (5-HT7)
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-7 | 5-HT-X | 5-HT7 | 5-HT7L | 5-HT7S | 5-HT7b | 5-hydroxytryptamine receptor 7 | 5HT7 | HTR7
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:53573.08
Organism:Homo sapiens (Human)
Description:P34969
Residue:479
Sequence:
MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTW
DAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLI
VSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDR
YLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYT
IYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVE
ECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSC
IPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALK
LAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50130279
n/a
NameBDBM50130279
Synonyms:(R)-4-Methyl-1-(2-(1-toluene-3-sulfonyl)-pyrrolidin-2-yl)-ethyl)-piperidine (Oxalate salt) | 4-Methyl-1-{2-[(R)-1-(toluene-3-sulfonyl)-pyrrolidin-2-yl]-ethyl}-piperidine | 4-Methyl-1-{2-[(S)-1-(toluene-3-sulfonyl)-pyrrolidin-2-yl]-ethyl}-piperidine | 4-Methyl-1-{2-[1-(toluene-3-sulfonyl)-pyrrolidin-2-yl]-ethyl}-piperidine | CHEMBL12624 | SB-258741
TypeSmall organic molecule
Emp. Form.C19H30N2O2S
Mol. Mass.350.519
SMILESCC1CCN(CC[C@H]2CCCN2S(=O)(=O)c2cccc(C)c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: