Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targethistone lysine demethylase PHF8 isoform 2
LigandBDBM276044
Substrate/Competitorn/a
Meas. Tech.PHF8 Assay
Temperature298.15±n/a K
IC50<100±n/a nM
Commentsextracted
Citation Chen YKNie ZStafford JAVeal JM Histone demethylase inhibitors US Patent  US10071984 Publication Date 9/11/2018
More Info.:Get all data from this article,  Assay Method
 
histone lysine demethylase PHF8 isoform 2
Name:histone lysine demethylase PHF8 isoform 2
Synonyms:NP_055922 | PHF8
Type:Enzyme Catalytic Domain
Mol. Mass.:113932.27
Organism:Homo sapiens (Human)
Description:n/a
Residue:1024
Sequence:
MASVPVYCLCRLPYDVTRFMIECDMCQDWFHGSCVGVEEEKAADIDLYHCPNCEVLHGPS
IMKKRRGSSKGHDTHKGKPVKTGSPTFVRELRSRTFDSSDEVILKPTGNQLTVEFLEENS
FSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYY
SGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVR
DSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKC
YKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFR
FPNFETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEI
PETVRTVQLIKDLAREIRLVEDIFQQNVGKTSNIFGLQRIFPAGSIPLTRPAHSTSVSMS
RLSLPSKNGSKKKGLKPKELFKKAERKGKESSALGPAGQLSYNLMDTYSHQALKTGSFQK
AKFNITGACLNDSDDDSPDLDLDGNESPLALLMSNGSTKRVKSLSKSRRTKIAKKVDKAR
LMAEQVMEDEFDLDSDDELQIDERLGKEKATLIIRPKFPRKLPRAKPCSDPNRVREPGEV
EFDIEEDYTTDEDMVEGVEGKLGNGSGAGGILDLLKASRQVGGPDYAALTEAPASPSTQE
AIQGMLCMANLQSSSSSPATSSLQAWWTGGQDRSSGSSSSGLGTVSNSPASQRTPGKRPI
KRPAYWRTESEEEEENASLDEQDSLGACFKDAEYIYPSLESDDDDPALKSRPKKKKNSDD
APWSPKARVTPTLPKQDRPVREGTRVASIETGLAAAAAKLAQQELQKAQKKKYIKKKPLL
KEVEQPRPQDSNLSLTVPAPTVAATPQLVTSSSPLPPPEPKQEALSGSLADHEYTARPNA
FGMAQANRSTTPMAPGVFLTQRRPSVGSQSNQAGQGKRPKKGLATAKQRLGRILKIHRNG
KLLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM276044
n/a
NameBDBM276044
Synonyms:2-[1-[2-(2-chlorophenyl)ethyl]imidazol-4-yl]-4-(1H-triazol-4-yl)pyridine | US10071984, Example 6 | US10174003, Example 6
TypeSmall organic molecule
Emp. Form.C18H15ClN6
Mol. Mass.350.805
SMILESClc1ccccc1CCn1cnc(c1)-c1cc(ccn1)-c1c[nH]nn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: