Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM21244
Substrate/Competitorn/a
Ki 0.64±n/a nM
CommentsPDSP_572
Citation Griffin GTao QAbood ME Cloning and pharmacological characterization of the rat CB(2) cannabinoid receptor. J Pharmacol Exp Ther 292:886-94 (2000) [PubMed]
More Info.:Get all data from this article
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CNR2 | Cannabinoid CB2 receptor | Cannabinoid receptor | rCB2
Type:Enzyme
Mol. Mass.:39366.68
Organism:Rattus norvegicus (Rat)
Description:Q9QZN9
Residue:360
Sequence:
MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILS
SQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKIGSVTMTFTAS
VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCS
ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHVASLAEHQDRQVPGIARMRLD
VRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYA
LRSGEIRSAAQHCLTGWKKYLQGLGSEGKEEAPKSSVTETEAEVKTTTGPGSRTPGCSNC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21244
n/a
NameBDBM21244
Synonyms:2-[(1S,2S,5S)-5-hydroxy-2-(3-hydroxypropyl)cyclohexyl]-5-(2-methyloctan-2-yl)phenol | 3-(2-hydroxy-4-(1,1-dimethylheptyl)phenyl)-4-(3-hydroxypropyl)cyclohexanol | CP 55,940 | CP-55,940 | CP-56667 [(+)-AC],XV | [3H]-56 | [3H]CP55940
Typeradiolabeled ligand
Emp. Form.C24H40O3
Mol. Mass.376.5726
SMILESCCCCCCC(C)(C)c1ccc([C@H]2C[C@@H](O)CC[C@@H]2CCCO)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: