Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50330773
Substrate/Competitorn/a
Ki 3.16±n/a nM
CommentsPDSP_1008
Citation Griffin GTao QAbood ME Cloning and pharmacological characterization of the rat CB(2) cannabinoid receptor. J Pharmacol Exp Ther 292:886-94 (2000) [PubMed]
More Info.:Get all data from this article
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CNR2 | Cannabinoid CB2 receptor | Cannabinoid receptor | rCB2
Type:Enzyme
Mol. Mass.:39366.68
Organism:Rattus norvegicus (Rat)
Description:Q9QZN9
Residue:360
Sequence:
MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILS
SQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKIGSVTMTFTAS
VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCS
ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHVASLAEHQDRQVPGIARMRLD
VRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYA
LRSGEIRSAAQHCLTGWKKYLQGLGSEGKEEAPKSSVTETEAEVKTTTGPGSRTPGCSNC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50330773
n/a
NameBDBM50330773
Synonyms:((6aR,10aR)-6,6-dimethyl-3-(2-methyloctan-2-yl)-6a,7,10,10a-tetrahydro-6H-benzo[c]chromen-9-yl)methanol | CHEMBL1277685 | JWH-051
TypeSmall organic molecule
Emp. Form.C25H38O2
Mol. Mass.370.568
SMILESCCCCCCC(C)(C)c1ccc2[C@@H]3CC(CO)=CC[C@H]3C(C)(C)Oc2c1 |r,c:17|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: