Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM21280
Substrate/Competitorn/a
Ki 0.05±n/a nM
CommentsPDSP_1751
Citation Griffin GTao QAbood ME Cloning and pharmacological characterization of the rat CB(2) cannabinoid receptor. J Pharmacol Exp Ther 292:886-94 (2000) [PubMed]
More Info.:Get all data from this article
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CNR2 | Cannabinoid CB2 receptor | Cannabinoid receptor | mCB2
Type:Enzyme Catalytic Domain
Mol. Mass.:38220.43
Organism:MOUSE
Description:P47936
Residue:347
Sequence:
MEGCRETEVTNGSNGGLEFNPMKEYMILSSGQQIAVAVLCTLMGLLSALENMAVLYIILS
SRRLRRKPSYLFISSLAGADFLASVIFACNFVIFHVFHGVDSNAIFLLKIGSVTMTFTAS
VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALCVMWVLSALISYLPLMGWTCCPSPCS
ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHRHVATLAEHQDRQVPGIARMRLD
VRLAKTLGLVLAVLLICWFPALALMGHSLVTTLSDQVKEAFAFCSMLCLVNSMVNPIIYA
LRSGEIRSAAQHCLIGWKKYLQGLGPEGKEEGPRSSVTETEADVKTT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21280
n/a
NameBDBM21280
Synonyms:5-(4-chloro-3-methylphenyl)-1-[(4-methylphenyl)methyl]-N-[(1S)-1,3,3-trimethylbicyclo[2.2.1]heptan-2-yl]-1H-pyrazole-3-carboxamide | N-(1,3,3-trimethylbicyclo(2.2.1)heptan-2-yl)-5-(4-chloro-3-methylphenyl)-1-(4-methylbenzyl)pyrazole-3-carboxamide | SR 144528 | SR-144528 | SR144528
TypeSmall organic molecule
Emp. Form.C29H34ClN3O
Mol. Mass.476.053
SMILESCc1ccc(Cn2nc(cc2-c2ccc(Cl)c(C)c2)C(=O)NC2[C@@]3(C)CCC(C3)C2(C)C)cc1 |r,TLB:21:22:28:26.25|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: