Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLTB4R
LigandBDBM79408
Substrate/Competitorn/a
Ki 25±n/a nM
CommentsPDSP_1937
Citation Wang SGustafson EPang LQiao XBehan JMaguire MBayne MLaz T A novel hepatointestinal leukotriene B4 receptor. Cloning and functional characterization. J Biol Chem 275:40686-94 (2000) [PubMed]  Article
More Info.:Get all data from this article
 
LTB4R
Name:Leukotriene B4 receptor
Synonyms:Chemoattractant receptor-like 1 | G-protein coupled receptor 16 | LTB4-R 1 | Leukotriene B4 R1 | Leukotriene B4 receptor | Leukotriene B4 receptor 1 | P2Y purinoceptor 7 | P2Y7
Type:Enzyme Catalytic Domain
Mol. Mass.:37582.68
Organism:Homo sapiens (Human)
Description:Leukotriene B4 R1 LTB4R HUMAN::Q15722
Residue:352
Sequence:
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM79408
n/a
NameBDBM79408
Synonyms:(5R)-6-[6-[(1E,3S,5Z)-3-hydroxyundeca-1,5-dienyl]-2-pyridinyl]hexane-1,5-diol | (5R)-6-[6-[(1E,3S,5Z)-3-hydroxyundeca-1,5-dienyl]-2-pyridyl]hexane-1,5-diol | (5R)-6-[6-[(1E,3S,5Z)-3-hydroxyundeca-1,5-dienyl]pyridin-2-yl]hexane-1,5-diol | (5R)-6-[6-[(1E,3S,5Z)-3-oxidanylundeca-1,5-dienyl]pyridin-2-yl]hexane-1,5-diol | MLS000028864 | SMR000058935 | U-75302 | cid_6852392
TypeSmall organic molecule
Emp. Form.C22H35NO3
Mol. Mass.361.5182
SMILESCCCCC\C=C/C[C@H](O)\C=C\c1cccc(C[C@H](O)CCCCO)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: