Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPotassium Channel (Ca2+ dependent)
LigandBDBM50094703
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_2986
Citation Jarvis MFYu HKohlhaas KAlexander KLee CHJiang MBhagwat SSWilliams MKowaluk EA ABT-702 (4-amino-5-(3-bromophenyl)-7-(6-morpholinopyridin-3-yl)pyrido[2, 3-d]pyrimidine), a novel orally effective adenosine kinase inhibitor with analgesic and anti-inflammatory properties: I. In vitro characterization and acute antinociceptive effects in the mouse. J Pharmacol Exp Ther 295:1156-64 (2000) [PubMed]
More Info.:Get all data from this article
 
Potassium Channel (Ca2+ dependent)
Name:Potassium Channel (Ca2+ dependent)
Synonyms:Calcium-activated potassium channel subunit beta-1
Type:Enzyme Catalytic Domain
Mol. Mass.:21917.35
Organism:RAT
Description:Potassium Channel (Ca2+ dependent) 0 RAT::P97678
Residue:191
Sequence:
MGKKLVMAQKRGETRALCLGVAMVVCAAITYYILGTTVLPLYQKSVWTQESTCHLVETNI
KDQEELEGRKVPQYPCLWVNVSAVGRWAMLYHTEDTRDQNQQCSYIPRNLDNYQTALVDV
KKVRANFYKHHNFYCFSAPQVNETSVVYQRLYGPQILLFSFFWPTFLLTGGLLIIAMVKL
NRSLSVLAAQK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50094703
n/a
NameBDBM50094703
Synonyms:5-(3-Bromo-phenyl)-7-(6-morpholin-4-yl-pyridin-3-yl)-pyrido[2,3-d]pyrimidin-4-ylamine | 5-(3-bromophenyl)-7-(6-morpholin-4-ylpyridin-3-yl)pyrido[2,3-d]pyrimidin-4-ylamine | ABT-702 | CHEMBL66089
TypeSmall organic molecule
Emp. Form.C22H19BrN6O
Mol. Mass.463.33
SMILESNc1ncnc2nc(cc(-c3cccc(Br)c3)c12)-c1ccc(nc1)N1CCOCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: