Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP2X purinoceptor 1
LigandBDBM85682
Substrate/Competitorn/a
Ki 1000±n/a nM
CommentsPDSP_3351
Citation Lambrecht G Agonists and antagonists acting at P2X receptors: selectivity profiles and functional implications. Naunyn Schmiedebergs Arch Pharmacol 362:340-50 (2000) [PubMed]  Article
More Info.:Get all data from this article
 
P2X purinoceptor 1
Name:P2X purinoceptor 1
Synonyms:ATP receptor | P2X1 | Purinergic receptor | Purinergic, P2X1 | RP-2 protein
Type:Enzyme Catalytic Domain
Mol. Mass.:44969.95
Organism:RAT
Description:Purinergic, P2X1 0 RAT::P47824
Residue:399
Sequence:
MARRLQDELSAFFFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFVYEKGYQTSSD
LISSVSVKLKGLAVTQLQGLGPQVWDVADYVFPAHGDSSFVVMTNFIVTPQQTQGHCAEN
PEGGICQDDSGCTPGKAERKAQGIRTGNCVPFNGTVKTCEIFGWCPVEVDDKIPSPALLR
EAENFTLFIKNSISFPRFKVNRRNLVEEVNGTYMKKCLYHKIQHPLCPVFNLGYVVRESG
QDFRSLAEKGGVVGITIDWKCDLDWHVRHCKPIYQFHGLYGEKNLSPGFNFRFARHFVQN
GTNRRHLFKVFGIHFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKR
HYYKQKKFKYAEDMGPGEGEHDPVATSSTLGLQENMRTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85682
n/a
NameBDBM85682
Synonyms:CAS_5311315 | NF279 | NSC_5311315
TypeSmall organic molecule
Emp. Form.C49H30N6O23S6
Mol. Mass.1263.182
SMILES[O-]S(=O)(=O)c1cc(c2c(NC(=O)c3ccc(NC(=O)c4ccc(NC(=O)Nc5ccc(cc5)C(=O)Nc5ccc(cc5)C(=O)Nc5ccc(c6cc(cc(c56)S([O-])(=O)=O)S([O-])(=O)=O)S([O-])(=O)=O)cc4)cc3)ccc(c2c1)S([O-])(=O)=O)S([O-])(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: