Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurinergic, P2X2
LigandBDBM85730
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_3350
Citation Lambrecht G Agonists and antagonists acting at P2X receptors: selectivity profiles and functional implications. Naunyn Schmiedebergs Arch Pharmacol 362:340-50 (2000) [PubMed]  Article
More Info.:Get all data from this article
 
Purinergic, P2X2
Name:Purinergic, P2X2
Synonyms:ATP receptor | P2X purinoceptor 2 | P2X2 | P2X2/P2X3 receptor | Purinergic receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:52625.55
Organism:RAT
Description:Purinergic, P2X2 0 RAT::P49653
Residue:472
Sequence:
MVRRLARGCWSAFWDYETPKVIVVRNRRLGFVHRMVQLLILLYFVWYVFIVQKSYQDSET
GPESSIITKVKGITMSEDKVWDVEEYVKPPEGGSVVSIITRIEVTPSQTLGTCPESMRVH
SSTCHSDDDCIAGQLDMQGNGIRTGHCVPYYHGDSKTCEVSAWCPVEDGTSDNHFLGKMA
PNFTILIKNSIHYPKFKFSKGNIASQKSDYLKHCTFDQDSDPYCPIFRLGFIVEKAGENF
TELAHKGGVIGVIINWNCDLDLSESECNPKYSFRRLDPKYDPASSGYNFRFAKYYKINGT
TTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSIGVGSFLCDWILLTFMNKNK
LYSHKKFDKVRTPKHPSSRWPVTLALVLGQIPPPPSHYSQDQPPSPPSGEGPTLGEGAEL
PLAVQSPRPCSISALTEQVVDTLGQHMGQRPPVPEPSQQDSTSTDPKGLAQL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85730
n/a
NameBDBM85730
Synonyms:CAS_5311313 | NF023 | NSC_5311313
TypeSmall organic molecule
Emp. Form.C33H20N4O19S6
Mol. Mass.968.921
SMILES[O-]S(=O)(=O)c1cc(c2c(Nc3cccc(NC(=O)Nc4cccc(Nc5ccc(c6cc(cc(c56)S([O-])(=O)=O)S([O-])(=O)=O)S([O-])(=O)=O)c4)c3)ccc(c2c1)S([O-])(=O)=O)S([O-])(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: