Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP2X purinoceptor 3
LigandBDBM50000029
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_3349
Citation Lambrecht G Agonists and antagonists acting at P2X receptors: selectivity profiles and functional implications. Naunyn Schmiedebergs Arch Pharmacol 362:340-50 (2000) [PubMed]  Article
More Info.:Get all data from this article
 
P2X purinoceptor 3
Name:P2X purinoceptor 3
Synonyms:ATP receptor | P2X3 | P2rx3 | Purinergic receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:44397.63
Organism:RAT
Description:Purinergic, P2X3 0 RAT::P49654
Residue:397
Sequence:
MNCISDFFTYETTKSVVVKSWTIGIINRAVQLLIISYFVGWVFLHEKAYQVRDTAIESSV
VTKVKGFGRYANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPENEEKYRCVSDS
QCGPERFPGGGILTGRCVNYSSVLRTCEIQGWCPTEVDTVEMPIMMEAENFTIFIKNSIR
FPLFNFEKGNLLPNLTDKDIKRCRFHPEKAPFCPILRVGDVVKFAGQDFAKLARTGGVLG
IKIGWVCDLDKAWDQCIPKYSFTRLDGVSEKSSVSPGYNFRFAKYYKMENGSEYRTLLKA
FGIRFDVLVYGNAGKFNIIPTIISSVAAFTSVGVGTVLCDIILLNFLKGADHYKARKFEE
VTETTLKGTASTNPVFASDQATVEKQSTDSGAYSIGH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50000029
n/a
NameBDBM50000029
Synonyms:4-Methyl-8-{4-methyl-3-[3-(3-{3-[2-methyl-5-(4,6,8-trisulfo-naphthalen-1-ylcarbamoyl)-phenylcarbamoyl]-phenyl}-ureido)-benzoylamino]-benzoylamino}-naphthalene-1,3,5-trisulfonic acid; hexa-kis Sodium salt | 5,5',5''-[1,3,6-naphthalenetriyltris(sulfonylimino)]tris[1,3-benzenesulfonate analogue | CHEMBL265502 | SURAMIN HEXASODIUM | suramin | suramin Na
TypeSmall organic molecule
Emp. Form.C51H34N6O23S6
Mol. Mass.1291.235
SMILESCc1ccc(cc1NC(=O)c1cccc(NC(=O)Nc2cccc(c2)C(=O)Nc2cc(ccc2C)C(=O)Nc2ccc(c3cc(cc(c23)S([O-])(=O)=O)S([O-])(=O)=O)S([O-])(=O)=O)c1)C(=O)Nc1ccc(c2cc(cc(c12)S([O-])(=O)=O)S([O-])(=O)=O)S([O-])(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: