Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(2) dopamine receptor
LigandBDBM84994
Substrate/Competitorn/a
Ki 2±n/a nM
CommentsPDSP_1422
Citation Richelson ESouder T Binding of antipsychotic drugs to human brain receptors focus on newer generation compounds. Life Sci 68:29-39 (2000) [PubMed]  Article
More Info.:Get all data from this article
 
D(2) dopamine receptor
Name:Dopamine receptor D2L/neurotensin receptor NTS1
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DRD2 | Dopamine D2 receptor | Dopamine D2 receptor (D2) | Dopamine D2 receptor (D2R) | Dopamine D2A | Dopamine2-like
Type:Cell-surface receptors
Mol. Mass.:50647.10
Organism:Homo sapiens (Human)
Description:P14416
Residue:443
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM84994
n/a
NameBDBM84994
Synonyms:CAS_163091 | NSC_163091 | ORG-5222
TypeSmall organic molecule
Emp. Form.C17H16ClNO
Mol. Mass.285.768
SMILESCN1CC2C(C1)c1cc(Cl)ccc1Oc1ccccc21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: