Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H4 receptor
LigandBDBM50017674
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_673
Citation Liu CMa XJiang XWilson SJHofstra CLBlevitt JPyati JLi XChai WCarruthers NLovenberg TW Cloning and pharmacological characterization of a fourth histamine receptor (H(4)) expressed in bone marrow. Mol Pharmacol 59:420-6 (2001) [PubMed]  Article
More Info.:Get all data from this article
 
Histamine H4 receptor
Name:Histamine H4 receptor
Synonyms:AXOR35 | G-protein coupled receptor 105 | GPRv53 | HH4R | HISTAMINE H4 | Histamine H4 receptor (H4R) | Histamine receptor (H3 and H4) | Pfi-013 | SP9144
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44517.02
Organism:Homo sapiens (Human)
Description:Binding assays were using CHO cells stably expressing hH4R receptors.
Residue:390
Sequence:
MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50017674
n/a
NameBDBM50017674
Synonyms:(2-Benzhydryloxy-ethyl)-dimethyl-amine | 2-(benzhydryloxy)-N,N-dimethylethanamine | 2-(diphenylmethoxy)-N,N-dimethylethanamine | Antitussive | Beldin | Belix | Benadryl | Benylin | CHEMBL657 | DIMENHYDRINATE | DIPHENHYDRAMINE | Dibenil | Diphen | Hydramine | N-[2-(BENZHYDRYLOXY)ETHYL]-N,N-DIMETHYLAMINE | Silphen | US9138431, DIPHENHYDRAMINE (Benadryl) | US9333199, DIPHENHYDRAMINE (Benadryl)
TypeSmall organic molecule
Emp. Form.C17H21NO
Mol. Mass.255.3547
SMILESCN(C)CCOC(c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: