Reaction Details |
 | Report a problem with these data |
Target | Histamine H4 receptor |
---|
Ligand | BDBM50017674 |
---|
Substrate/Competitor | n/a |
---|
Ki | >10000±n/a nM |
---|
Comments | PDSP_673 |
---|
Citation | Liu C; Ma X; Jiang X; Wilson SJ; Hofstra CL; Blevitt J; Pyati J; Li X; Chai W; Carruthers N; Lovenberg TW Cloning and pharmacological characterization of a fourth histamine receptor (H(4)) expressed in bone marrow. Mol Pharmacol 59:420-6 (2001) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Histamine H4 receptor |
---|
Name: | Histamine H4 receptor |
Synonyms: | AXOR35 | G-protein coupled receptor 105 | GPRv53 | HH4R | HISTAMINE H4 | Histamine H4 receptor (H4R) | Histamine receptor (H3 and H4) | Pfi-013 | SP9144 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 44517.02 |
Organism: | Homo sapiens (Human) |
Description: | Binding assays were using CHO cells stably expressing hH4R receptors. |
Residue: | 390 |
Sequence: | MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
|
|
|
BDBM50017674 |
---|
n/a |
---|
Name | BDBM50017674 |
Synonyms: | (2-Benzhydryloxy-ethyl)-dimethyl-amine | 2-(benzhydryloxy)-N,N-dimethylethanamine | 2-(diphenylmethoxy)-N,N-dimethylethanamine | Antitussive | Beldin | Belix | Benadryl | Benylin | CHEMBL657 | DIMENHYDRINATE | DIPHENHYDRAMINE | Dibenil | Diphen | Hydramine | N-[2-(BENZHYDRYLOXY)ETHYL]-N,N-DIMETHYLAMINE | Silphen | US9138431, DIPHENHYDRAMINE (Benadryl) | US9333199, DIPHENHYDRAMINE (Benadryl) |
Type | Small organic molecule |
Emp. Form. | C17H21NO |
Mol. Mass. | 255.3547 |
SMILES | CN(C)CCOC(c1ccccc1)c1ccccc1 |
Structure |
|