Reaction Details |
| Report a problem with these data |
Target | Histamine H4 receptor |
---|
Ligand | BDBM22904 |
---|
Substrate/Competitor | n/a |
---|
Ki | 232±n/a nM |
---|
Comments | PDSP_1585 |
---|
Citation | Zhu, Y; Michalovich, D; Wu, H; Tan, KB; Dytko, GM; Mannan, IJ; Boyce, R; Alston, J; Tierney, LA; Li, X; Herrity, NC; Vawter, L; Sarau, HM; Ames, RS; Davenport, CM; Hieble, JP; Wilson, S; Bergsma, DJ; Fitzgerald, LR Cloning, expression, and pharmacological characterization of a novel human histamine receptor. Mol Pharmacol59:434-41 (2001) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Histamine H4 receptor |
---|
Name: | Histamine H4 receptor |
Synonyms: | AXOR35 | G-protein coupled receptor 105 | GPCR105 | GPRv53 | HH4R | HISTAMINE H4 | HRH4 | HRH4_HUMAN | Histamine H4 receptor | Histamine H4 receptor (H4R) | Histamine receptor (H3 and H4) | Pfi-013 | SP9144 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 44517.02 |
Organism: | Homo sapiens (Human) |
Description: | Binding assays were using CHO cells stably expressing hH4R receptors. |
Residue: | 390 |
Sequence: | MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
|
|
|
BDBM22904 |
---|
n/a |
---|
Name | BDBM22904 |
Synonyms: | (2R)-1-(1H-imidazol-5-yl)propan-2-amine | (R)-alpha-Methylhistamine | Alpha-Methylhistamine-R | Alpha-Methylhistane-R | CHEMBL268229 | R-alpha-methylhistamine | RAMH |
Type | Small organic molecule |
Emp. Form. | C6H11N3 |
Mol. Mass. | 125.1716 |
SMILES | C[C@@H](N)Cc1cnc[nH]1 |r| |
Structure |
|