Reaction Details |
| Report a problem with these data |
Target | Proto-oncogene tyrosine-protein kinase Src |
---|
Ligand | BDBM3431 |
---|
Substrate/Competitor | Poly(E:Y) |
---|
Meas. Tech. | Kinase Inhibition Assay |
---|
pH | 7.4±n/a |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 73±n/a nM |
---|
Citation | Schroeder, MC; Hamby, JM; Connolly, CJ; Grohar, PJ; Winters, RT; Barvian, MR; Moore, CW; Boushelle, SL; Crean, SM; Kraker, AJ; Driscoll, DL; Vincent, PW; Elliott, WL; Lu, GH; Batley, BL; Dahring, TK; Major, TC; Panek, RL; Doherty, AM; Showalter, HD Soluble 2-substituted aminopyrido[2,3-d]pyrimidin-7-yl ureas. Structure-activity relationships against selected tyrosine kinases and exploration of in vitro and in vivo anticancer activity. J Med Chem44:1915-26 (2001) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Proto-oncogene tyrosine-protein kinase Src |
---|
Name: | Proto-oncogene tyrosine-protein kinase Src |
Synonyms: | Calmodulin/Proto-oncogene tyrosine-protein kinase Src | Protein cereblon/Tyrosine-protein kinase SRC | Proto-oncogene c-Src | Proto-oncogene tyrosine-protein kinase Src (c-Src) | SRC | SRC1 | SRC_HUMAN | Tyrosine-protein kinase Src (SRC) | V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) | c-Src | p60-Src | pp60c-src |
Type: | Protein |
Mol. Mass.: | 59838.60 |
Organism: | Homo sapiens (Human) |
Description: | P12931 |
Residue: | 536 |
Sequence: | MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
|
|
|
BDBM3431 |
---|
Poly(E:Y) |
---|
Name: | Poly(E:Y) |
Synonyms: | n/a |
Type: | Random polymer |
Mol. Mass.: | 358.43 |
Organism: | n/a |
Description: | Random copolymer of glutamic acid and tyrosine (4:1). 50 uM ATP containing 0.4 uCi of [gamma-32P]ATP as co-substrate |
Residue: | 3 |
Sequence: | |