Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 4 (5-HT4)
LigandBDBM50327858
Substrate/Competitorn/a
Ki 0.05±n/a nM
CommentsPDSP_2064
Citation Bach TSyversveen TKvingedal AMKrobert KABrattelid TKaumann AJLevy FO 5HT4(a) and 5-HT4(b) receptors have nearly identical pharmacology and are both expressed in human atrium and ventricle. Naunyn Schmiedebergs Arch Pharmacol 363:146-60 (2001) [PubMed]  Article
More Info.:Get all data from this article
 
5-hydroxytryptamine receptor 4 (5-HT4)
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-4 | 5-HT4 | 5-HT4S | 5-HT4a | 5-HT4b | 5-HT4c | 5-HT4d | 5-HT4hb | 5-hydroxytryptamine receptor 4 | HTR4 | Serotonin (5-HT) receptor | Serotonin (5-HT3) receptor | Serotonin 4 (5-HT4) receptor | Serotonin Receptor 4
Type:Enzyme
Mol. Mass.:43767.54
Organism:Homo sapiens (Human)
Description:Q13639
Residue:388
Sequence:
MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP
QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESQCHPPATSPLVAAQPSDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50327858
n/a
NameBDBM50327858
Synonyms:(1-Butylpiperidin-4-yl)methyl 8-amino-7-iodo-2,3-dihydrobenzo-[b][1,4]dioxine-5-carboxylate | 8-Amino-7-iodo-2,3-dihydro-benzo[1,4]dioxine-5-carboxylic acid 1-butyl-piperidin-4-ylmethyl ester | CHEMBL114112 | SB-207710 | SB207710
TypeSmall organic molecule
Emp. Form.C19H27IN2O4
Mol. Mass.474.3332
SMILESCCCCN1CCC(COC(=O)c2cc(I)c(N)c3OCCOc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: