Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetadrenergic Alpha2
LigandBDBM35234
Substrate/Competitorn/a
Ki 57±n/a nM
CommentsPDSP_1348
Citation Naselsky DPAshton DRuffolo RRHieble JP Rabbit alpha2-adrenoceptors: both platelets and adipocytes have alpha2A-pharmacology. J Pharmacol Exp Ther 298:219-25 (2001) [PubMed]
More Info.:Get all data from this article
 
adrenergic Alpha2
Name:adrenergic Alpha2
Synonyms:Alpha-2B adrenergic receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:42909.14
Organism:RABBIT
Description:adrenergic Alpha2 0 RABBIT::O77830
Residue:394
Sequence:
AIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANE
LLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNCKRTPRRIKCII
LTVWLIAAAISLPPLIYKGDQGPQPHGAPQCKLNQEAWYILSSSLGSFFVPCLIMILVYL
RIYLIAKRSHRRGPRAKGGPGEGESRQACPVPGGPSASAKLPTLATPVASASEANGPSKP
AGEKEEGETPEDPGTQALPPGWATLPNSGQGQKEGVSGASLEEEAEEEEEEEEEEDEPQA
VPVSPASVGSPPLQQPQGSRVLATLRGQVLVGRGVGAMSGQWWRRRAQLSREKRFTFVLA
VVIGVFVLCWFPFFFSYSLSAICPQQCRVPHGLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM35234
n/a
NameBDBM35234
Synonyms:DL-[7-3H]norepinephrine | NOREPINEPHRINE | Noradrenaline,(+) | [3H]NE
Typeradiolabeled ligand
Emp. Form.C8H11NO3
Mol. Mass.169.1778
SMILESNCC(O)c1ccc(O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: