Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNPY2R
LigandBDBM50015490
Substrate/Competitorn/a
Ki 0.42±n/a nM
CommentsPDSP_1378
Citation Goumain MVoisin TLorinet AMDucroc RTsocas ARozé CRouet-Benzineb PHerzog HBalasubramaniam ALaburthe M The peptide YY-preferring receptor mediating inhibition of small intestinal secretion is a peripheral Y(2) receptor: pharmacological evidence and molecular cloning. Mol Pharmacol 60:124-34 (2001) [PubMed]  Article
More Info.:Get all data from this article
 
NPY2R
Name:Neuropeptide Y receptor type 2
Synonyms:NPY-Y2 | Neuropeptide Y receptor type 2 | Neuropeptide Y/peptide YY-Y2 receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:42514.44
Organism:RAT
Description:NPY-Y2 NPY2R RAT::Q9ERC0
Residue:381
Sequence:
MGPLGAEADENQTVEVKVELYGSGPTTPRGELPPDPEPELIDSTKLVEVQVVLILAYCSI
ILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGP
VLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKQISFLIIGLAWGVSALLA
SPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIISFSYT
RIWSKLKNHVSPGAASDHYHQRRHKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSHVLDL
KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSMTFKAK
KNLEVKKNNGLTDSFSEATNV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50015490
n/a
NameBDBM50015490
Synonyms:CHEMBL438945 | H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 | NPY | NPY, human | NPY, human, rat | Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro- Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His- Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 (NPY) | human Neuropeptide Y
TypeSmall organic molecule
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: