Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNPY2R
LigandBDBM85791
Substrate/Competitorn/a
Ki 1000±n/a nM
CommentsPDSP_1512
Citation Goumain MVoisin TLorinet AMDucroc RTsocas ARozé CRouet-Benzineb PHerzog HBalasubramaniam ALaburthe M The peptide YY-preferring receptor mediating inhibition of small intestinal secretion is a peripheral Y(2) receptor: pharmacological evidence and molecular cloning. Mol Pharmacol 60:124-34 (2001) [PubMed]  Article
More Info.:Get all data from this article
 
NPY2R
Name:Neuropeptide Y receptor type 2
Synonyms:NPY-Y2 | Neuropeptide Y receptor type 2 | Neuropeptide Y/peptide YY-Y2 receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:42514.44
Organism:RAT
Description:NPY-Y2 NPY2R RAT::Q9ERC0
Residue:381
Sequence:
MGPLGAEADENQTVEVKVELYGSGPTTPRGELPPDPEPELIDSTKLVEVQVVLILAYCSI
ILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGP
VLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKQISFLIIGLAWGVSALLA
SPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIISFSYT
RIWSKLKNHVSPGAASDHYHQRRHKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSHVLDL
KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSMTFKAK
KNLEVKKNNGLTDSFSEATNV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85791
n/a
NameBDBM85791
Synonyms:CAS_59763-91-6 | NSC_41735 | PP, rat
TypeSmall organic molecule
Emp. Form.C31H24O3
Mol. Mass.444.5205
SMILESOc1c(C2CC(Cc3ccccc23)c2ccc(cc2)-c2ccccc2)c(=O)oc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: