Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNPY2R
LigandBDBM82420
Substrate/Competitorn/a
Ki 0.12±n/a nM
CommentsPDSP_1557
Citation Goumain MVoisin TLorinet AMDucroc RTsocas ARozé CRouet-Benzineb PHerzog HBalasubramaniam ALaburthe M The peptide YY-preferring receptor mediating inhibition of small intestinal secretion is a peripheral Y(2) receptor: pharmacological evidence and molecular cloning. Mol Pharmacol 60:124-34 (2001) [PubMed]  Article
More Info.:Get all data from this article
 
NPY2R
Name:Neuropeptide Y receptor type 2
Synonyms:NPY-Y2 | Neuropeptide Y receptor type 2 | Neuropeptide Y/peptide YY-Y2 receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:42514.44
Organism:RAT
Description:NPY-Y2 NPY2R RAT::Q9ERC0
Residue:381
Sequence:
MGPLGAEADENQTVEVKVELYGSGPTTPRGELPPDPEPELIDSTKLVEVQVVLILAYCSI
ILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGP
VLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKQISFLIIGLAWGVSALLA
SPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIISFSYT
RIWSKLKNHVSPGAASDHYHQRRHKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSHVLDL
KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSMTFKAK
KNLEVKKNNGLTDSFSEATNV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82420
n/a
NameBDBM82420
Synonyms:NPY, C2 | NPY, C2, porcine | PYY 3-36, porcine
TypeSmall organic molecule
Emp. Form.C96H160N32O23S2
Mol. Mass.2194.628
SMILESCC[C@H](C)[C@H](NC(=O)[C@@H](CS)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@H](CCCN=C(N)N)NC(=O)CCCCCCCNC(=O)[C@@H](CCCCN)NC(=O)[C@@H](CO)NC(=O)[C@@H](CS)NC(=O)[C@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(N)=O |r,wU:14.21,2.2,79.80,95.96,96.98,110.111,130.131,45.51,60.63,wD:8.10,4.4,24.32,87.88,103.104,104.107,121.122,141.142,54.57,66.67,(12.61,11.35,;12.61,9.83,;11.32,9.08,;10.01,9.83,;11.32,7.56,;12.67,6.79,;14.07,7.56,;14.07,9.14,;15.42,6.79,;15.44,5.3,;14.12,4.5,;16.56,7.56,;17.92,6.79,;19.27,7.56,;17.92,5.19,;16.11,4.26,;16.11,3.19,;15.19,2.51,;15.5,1.43,;16.63,1.43,;17.08,2.47,;19.27,4.42,;19.27,2.82,;17.92,2.07,;20.68,2.03,;22.03,2.74,;22.06,4.3,;23.41,4.96,;23.41,6.5,;24.78,7.19,;26.07,6.34,;24.78,8.69,;20.68,.49,;22.03,-.24,;23.39,.55,;22.03,-1.86,;20.7,-2.63,;19.37,-1.86,;18.28,-2.95,;16.94,-2.18,;15.86,-3.27,;14.52,-2.5,;13.19,-3.27,;11.85,-2.5,;11.85,-.96,;10.52,-3.27,;10.92,-4.76,;9.59,-5.53,;9.98,-7.01,;8.65,-7.78,;9.05,-9.27,;9.19,-2.5,;7.85,-3.27,;7.85,-4.81,;6.52,-2.5,;6.52,-.96,;7.85,-.19,;5.19,-3.27,;3.7,-2.87,;3.7,-1.33,;2.37,-3.64,;2.37,-5.18,;3.7,-5.95,;.88,-3.24,;-.46,-4.01,;-.46,-5.55,;-1.94,-3.61,;-3.03,-4.7,;-1.94,-2.07,;-3.28,-1.3,;-3.28,.24,;-4.61,1.01,;-5.94,.24,;-7.43,.63,;-5.94,-1.3,;-4.61,-2.07,;9.97,6.79,;9.92,5.28,;8.55,7.56,;7.28,6.79,;7.28,5.25,;5.97,4.51,;4.74,5.28,;5.99,3.09,;5.87,7.56,;5.87,9.14,;4.58,6.79,;3.23,7.56,;3.23,9.08,;1.87,9.83,;1.89,11.25,;.52,9.23,;1.87,6.79,;1.89,5.3,;.54,7.52,;-.75,6.75,;-.69,5.28,;-1.94,4.38,;.56,4.61,;.75,3.01,;-2.12,7.52,;-2.14,9.1,;-3.47,6.67,;-4.85,7.5,;-4.91,9.04,;-3.58,9.66,;-6.12,9.79,;-6.22,6.67,;-6.26,5.15,;-7.55,7.52,;-8.99,6.75,;-8.91,5.28,;-10.24,4.42,;-10.13,2.94,;-11.44,2.13,;-11.44,.59,;-12.71,-.2,;-10.11,-.09,;-10.34,7.52,;-10.26,8.98,;-11.57,6.67,;-13.03,7.46,;-12.94,9,;-14.27,9.71,;-14.25,11.23,;-12.96,11.91,;-15.52,11.91,;-14.32,6.73,;-14.32,5.17,;-15.63,7.46,;-17,6.63,;-16.98,5.11,;-18.19,4.3,;-18.12,2.82,;-19.39,2.01,;-19.27,.53,;-20.52,-.32,;-18.04,-.2,;-18.41,7.4,;-18.37,8.85,;-19.77,6.52,;-21.16,7.29,;-21.18,8.85,;-22.24,9.58,;-23.62,8.94,;-24.89,9.71,;-24.86,11.27,;-26.07,12.08,;-23.53,11.93,;-22.2,11.1,;-22.72,6.57,;-24.05,7.73,;-22.72,5.17,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: