| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin-H2 D-isomerase |
|---|
| Ligand | BDBM50008805 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 0.34±n/a nM |
|---|
| Comments | PDSP_2289 |
|---|
| Citation |  Arimura, A; Yasui, K; Kishino, J; Asanuma, F; Hasegawa, H; Kakudo, S; Ohtani, M; Arita, H Prevention of allergic inflammation by a novel prostaglandin receptor antagonist, S-5751. J Pharmacol Exp Ther298:411-9 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Prostaglandin-H2 D-isomerase |
|---|
| Name: | Prostaglandin-H2 D-isomerase |
|---|
| Synonyms: | PDS | PGD2 | PTGDS | PTGDS_HUMAN |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 21031.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | PGD2 0 HUMAN::P41222 |
|---|
| Residue: | 190 |
|---|
| Sequence: | MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLREKKA
ALSMCKSVVAPATDGGLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSV
VETDYDQYALLYSQGSKGPGEDFRMATLYSRTQTPRAELKEKFTAFCKAQGFTEDTIVFL
PQTDKCMTEQ
|
|
|
|---|
| BDBM50008805 |
|---|
| n/a |
|---|
| Name | BDBM50008805 |
|---|
| Synonyms: | 7-(3-Benzenesulfonylamino-bicyclo[2.2.1]hept-2-yl)-hept-5-enoic acid | CHEMBL56941 | S 145 | S-145,(+) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H27NO4S |
|---|
| Mol. Mass. | 377.498 |
|---|
| SMILES | OC(=O)CCC\C=C/C[C@H]1[C@@H]2CCC(C2)C1NS(=O)(=O)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
