Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTRAR1
LigandBDBM22872
Substrate/Competitorn/a
Ki 493±n/a nM
CommentsPDSP_1402
Citation Borowsky BAdham NJones KARaddatz RArtymyshyn ROgozalek KLDurkin MMLakhlani PPBonini JAPathirana SBoyle NPu XKouranova ELichtblau HOchoa FYBranchek TAGerald C Trace amines: identification of a family of mammalian G protein-coupled receptors. Proc Natl Acad Sci U S A 98:8966-71 (2001) [PubMed]  Article
More Info.:Get all data from this article
 
TRAR1
Name:Trace amine-associated receptor 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:39107.47
Organism:Homo sapiens (Human)
Description:ChEMBL_792734
Residue:339
Sequence:
MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNW
LIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISID
RYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRG
GCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNG
ISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFN
PMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22872
n/a
NameBDBM22872
Synonyms:1-(3-chloro-5,6-dihydrobenzo[b][1]benzothiepin-5-yl)-4-methyl-piperazine;maleate | 1-(8-chloro-10,11-dihydrodibenzo[b,f]thiepin-10-yl)-4-methylpiperazine | 1-{6-chloro-2-thiatricyclo[9.4.0.0^{3,8}]pentadeca-1(15),3(8),4,6,11,13-hexaen-9-yl}-4-methylpiperazine | CHEMBL64249 | CLOROTEPINE (+) | CLOROTEPINE(-) | Clothepin | OCTOCLOTHEPIN,(+) | OCTOCLOTHEPIN,(-) | Octoclothepin | Octoclothepine
TypeSmall organic molecule
Emp. Form.C19H21ClN2S
Mol. Mass.344.901
SMILESCN1CCN(CC1)C1Cc2ccccc2Sc2ccc(Cl)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: