Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin receptor 2a and 2c (5HT2A and 5HT2C)
LigandBDBM85818
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_2009
Citation Roth BLErnsberger PSteinberg SARao SRauser LSavage JHufeisen SBerridge MSMuzic RF The in vitro pharmacology of the beta-adrenergic receptor pet ligand (s)-fluorocarazolol reveals high affinity for cloned beta-adrenergic receptors and moderate affinity for the human 5-HT1A receptor. Psychopharmacology (Berl) 157:111-4 (2001) [PubMed]  Article
More Info.:Get all data from this article
 
Serotonin receptor 2a and 2c (5HT2A and 5HT2C)
Name:Serotonin receptor 2a and 2c (5HT2A and 5HT2C)
Synonyms:5-HT2C | 5-hydroxytryptamine receptor 2C | 5-hydroxytryptamine receptor 2C (5HT2c) | HTR2C
Type:Enzyme
Mol. Mass.:51935.10
Organism:Rattus norvegicus (Rat)
Description:P08909
Residue:460
Sequence:
MVNLGNAVRSLLMHLIGLLVWQFDISISPVAAIVTDTFNSSDGGRLFQFPDGVQNWPALS
IVVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYV
WPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVW
AISIGVSVPIPVIGLRDESKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYFLTIY
VLRRQTLMLLRGHTEEELANMSLNFLNCCCKKNGGEEENAPNPNPDQKPRRKKKEKRPRG
TMQAINNEKKASKVLGIVFFVFLIMWCPFFITNILSVLCGKACNQKLMEKLLNVFVWIGY
VCSGINPLVYTLFNKIYRRAFSKYLRCDYKPDKKPPVRQIPRVAATALSGRELNVNIYRH
TNERVARKANDPEPGIEMQVENLELPVNPSNVVSERISSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85818
n/a
NameBDBM85818
Synonyms:Fluorocarazolol,(R) | Fluorocarazolol,(S)
TypeSmall organic molecule
Emp. Form.C18H21FN2O2
Mol. Mass.316.3699
SMILESCC(CF)NCC(O)COc1cccc2[nH]c3ccccc3c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: