Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCGRP
LigandBDBM85843
Substrate/Competitorn/a
Ki 21±n/a nM
CommentsPDSP_2303
Citation Rorabaugh BRScofield MASmith DDJeffries WBAbel PW Functional calcitonin gene-related peptide subtype 2 receptors in porcine coronary arteries are identified as calcitonin gene-related peptide subtype 1 receptors by radioligand binding and reverse transcription-polymerase chain reaction. J Pharmacol Exp Ther 299:1086-94 (2001) [PubMed]
More Info.:Get all data from this article
 
CGRP
Name:CGRP
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:53657.10
Organism:PIG
Description:CGRP 0 PIG::Q8WN93
Residue:462
Sequence:
MEKKYILYFLFLLPFFMILVIAETEEENPDDLIQLTVTRNKIMTAQYECYQKIMQDPIQQ
TEGIYCNRTWDGWLCWNDVAAGTESMQHCPDYFQDFDPSEKVTKICDQDGNWFRHPESNR
TWTNYTQCNINTHEKVQTALNLFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKN
LFFSFVCNSIVTIIHLTAVANNQALVATNPVSCKVFQFIHLYLMGCNYFWMLCEGIYLHT
LIVVAVFAEKQHLMWYYFLGWGFPLIPACIHAVARRLYYNDNCWISSDTHLLYIIHGPIC
AALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGK
IAEEVYDYIMHILVHYQGLLVSTIYCFFNGEVQAILRRNWNQYKIQFGNSFSHSDALRSA
SYTVSTISDGAGYSHDYPSEHLNGKSIHDMENIVIKPEKLYD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85843
n/a
NameBDBM85843
Synonyms:[D-Pen2,7]h alpha-CGRP
TypeSmall organic molecule
Emp. Form.C171H289N51O49S2
Mol. Mass.3907.567
SMILES[#6]-[#6](-[#6])-[#6]-[#6](-[#7]-[#6](=O)-[#6]-[#7]-[#6](=O)-[#6](-[#6])-[#7]-[#6](=O)-[#6](-[#6]-[#6](-[#6])-[#6])-[#7]-[#6](=O)-[#6](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#7]-[#6](=O)-[#6](-[#6]-[#6]-1-[#6]-[#7]-[#6]-[#7]-1)-[#7]-[#6](=O)-[#6](-[#7]-[#6](=O)-[#6](-[#7]-[#6](=O)-[#6](-[#7]-[#6](=O)-[#6](-[#7]-[#6](=O)-[#6](-[#6])-[#7]-[#6](=O)-[#6](-[#7]-[#6](=O)-[#6](-[#6]-[#6](-[#8])=O)-[#7]-[#6](=O)-[#6](-[#7]-[#6](=O)-[#6](-[#6])-[#7])-[#6](-[#6])C([#6])([#6])[#16])-[#6](-[#6])-[#8])-[#6](-[#6])-[#8])-[#6](-[#6])C([#6])([#6])[#16])-[#6](-[#6])-[#6])-[#6](-[#6])-[#8])-[#6](=O)-[#7]-[#6](-[#6]-[#6](-[#6])-[#6])-[#6](=O)-[#7]-[#6](-[#6]-[#8])-[#6](=O)-[#7]-[#6](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](=O)-[#7]-[#6](-[#6]-[#8])-[#6](=O)-[#7]-[#6]-[#6](=O)-[#7]-[#6]-[#6](=O)-[#7]-[#6](-[#6](-[#6])-[#6])-[#6](=O)-[#7]-[#6](-[#6](-[#6])-[#6])-[#6](=O)-[#7]-[#6](-[#6]-[#6]-[#6]-[#6]-[#7])-[#6](=O)-[#7]-[#6](-[#6]-[#6](-[#7])=O)-[#6](=O)-[#7]-[#6](-[#6]-[#6](-[#7])=O)-[#6](=O)-[#7]-[#6](-[#6]-c1ccccc1)-[#6](=O)-[#7]-[#6](-[#6](-[#6])-[#6])-[#6](=O)-[#7]-1-[#6]-[#6]-[#6]-[#6]-1-[#6](=O)-[#7]-[#6](-[#6](-[#6])-[#8])-[#6](=O)-[#7]-[#6](-[#6]-[#6](-[#7])=O)-[#6](=O)-[#7]-[#6](-[#6](-[#6])-[#6])-[#6](=O)-[#7]-[#6]-[#6](=O)-[#7]-[#6](-[#6]-[#8])-[#6](=O)-[#7]-[#6](-[#6]-[#6]-[#6]-[#6]-[#7])-[#6](=O)-[#7]-[#6](-[#6])-[#6](=O)-[#7]-[#6](-[#6]-c1ccccc1)-[#6](-[#7])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: