| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Receptor activity-modifying protein 1 |
|---|
| Ligand | BDBM50000743 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 5.7±n/a nM |
|---|
| Comments | PDSP_2301 |
|---|
| Citation |  Rorabaugh, BR; Scofield, MA; Smith, DD; Jeffries, WB; Abel, PW Functional calcitonin gene-related peptide subtype 2 receptors in porcine coronary arteries are identified as calcitonin gene-related peptide subtype 1 receptors by radioligand binding and reverse transcription-polymerase chain reaction. J Pharmacol Exp Ther299:1086-94 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Receptor activity-modifying protein 1 |
|---|
| Name: | Receptor activity-modifying protein 1 |
|---|
| Synonyms: | CGRP1 | RAMP1 | RAMP1_PIG | Receptor activity-modifying protein 1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 16766.13 |
|---|
| Organism: | PIG |
|---|
| Description: | CGRP1 RAMP1 PIG::Q867C0 |
|---|
| Residue: | 148 |
|---|
| Sequence: | MARGLRGLPRRGLWLLLVNHLFLATACQDTDHAALLRKYCLPQFQVDMEAIGKALWCDWD
KTIGSYKDLSDCTRLVAQRLDCFWPNAAVDKFFLGVHQQYFRNCPVSGRALQDPPSSVLC
PFIVVPILATLLMTALVVWRSKRPEGIV
|
|
|
|---|
| BDBM50000743 |
|---|
| n/a |
|---|
| Name | BDBM50000743 |
|---|
| Synonyms: | CHEMBL525571 | [Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Val-Val-Lys-Asn-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2] hC | h alpha-CGRP8-37 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C139H230N44O38 |
|---|
| Mol. Mass. | 3125.5855 |
|---|
| SMILES | CC(C)C[C@H](NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@@H](NC(=O)[C@@H](N)C(C)C)[C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1ccccc1)C(N)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
