Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRAMP1
LigandBDBM85839
Substrate/Competitorn/a
Ki 118.2±n/a nM
CommentsPDSP_2307
Citation Rorabaugh BRScofield MASmith DDJeffries WBAbel PW Functional calcitonin gene-related peptide subtype 2 receptors in porcine coronary arteries are identified as calcitonin gene-related peptide subtype 1 receptors by radioligand binding and reverse transcription-polymerase chain reaction. J Pharmacol Exp Ther 299:1086-94 (2001) [PubMed]
More Info.:Get all data from this article
 
RAMP1
Name:RAMP1
Synonyms:CGRP1 | Receptor activity-modifying protein 1
Type:Enzyme Catalytic Domain
Mol. Mass.:16766.13
Organism:PIG
Description:CGRP1 RAMP1 PIG::Q867C0
Residue:148
Sequence:
MARGLRGLPRRGLWLLLVNHLFLATACQDTDHAALLRKYCLPQFQVDMEAIGKALWCDWD
KTIGSYKDLSDCTRLVAQRLDCFWPNAAVDKFFLGVHQQYFRNCPVSGRALQDPPSSVLC
PFIVVPILATLLMTALVVWRSKRPEGIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85839
n/a
NameBDBM85839
Synonyms:[Pro34,Phe35]h alpha-CGRP27-37
TypeSmall organic molecule
Emp. Form.C46H66N11O11
Mol. Mass.949.0833
SMILES[H][N]1([#6]-[#6]-[#6]-[#6@H]1-[#6](=O)-[#7]-[#6@@H](-[#6]-c1ccccc1)-[#6](=O)-[#7]-[#6@@H](-[#6])-[#6](=O)-[#7]-[#6@@H](-[#6]-c1ccccc1)-[#6](-[#7])=O)[#6](=O)-[#6]-[#7]-[#6](=O)-[#6@@H](-[#7]-[#6](=O)-[#6@H](-[#6]-[#6](-[#7])=O)-[#7]-[#6](=O)-[#6@@H](-[#7]-[#6](=O)-[#6@@H]-1-[#6]-[#6]-[#6]-[#7]-1)-[#6@@H](-[#6])-[#8])-[#6](-[#6])-[#6]
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: