| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Renal Outer Medullary Potassium (ROMK) |
|---|
| Ligand | BDBM82071 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 1000±n/a nM |
|---|
| Comments | PDSP_1947 |
|---|
| Citation |  Bymaster FP; Dreshfield-Ahmad LJ; Threlkeld PG; Shaw JL; Thompson L; Nelson DL; Hemrick-Luecke SK; Wong DT Comparative affinity of duloxetine and venlafaxine for serotonin and norepinephrine transporters in vitro and in vivo, human serotonin receptor subtypes, and other neuronal receptors. Neuropsychopharmacology 25:871-80 (2001) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Renal Outer Medullary Potassium (ROMK) |
|---|
| Name: | Renal Outer Medullary Potassium (ROMK) |
|---|
| Synonyms: | ATP-regulated potassium channel ROM-K | ATP-sensitive inward rectifier potassium channel 1 | Inward rectifier K(+) channel Kir1.1 | KAB-1 | Kcnj1 | Potassium channel (ATP modulatory) | Potassium channel, inwardly rectifying subfamily J member 1 | Renal Outer Medullary Potassium (ROMK1) | Romk1 | The Renal Outer Medullary Potassium (ROMK) channel (Kir1.1) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 44976.27 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | P35560 |
|---|
| Residue: | 391 |
|---|
| Sequence: | MGASERSVFRVLIRALTERMFKHLRRWFITHIFGRSRQRARLVSKEGRCNIEFGNVDAQS
RFIFFVDIWTTVLDLKWRYKMTVFITAFLGSWFLFGLLWYVVAYVHKDLPEFYPPDNRTP
CVENINGMTSAFLFSLETQVTIGYGFRFVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTITPEGE
TIILDQTNINFVVDAGNENLFFISPLTIYHIIDHNSPFFHMAAETLSQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFVPIVSKTKEGKYRVDFHNFGKTVEVETPHCAMCLY
NEKDARARMKRGYDNPNFVLSEVDETDDTQM
|
|
|
|---|
| BDBM82071 |
|---|
| n/a |
|---|
| Name | BDBM82071 |
|---|
| Synonyms: | CAS_93413-69-5 | CAS_99300-78-4 | NSC_62923 | VENLAFAXINE | Venlafaxine hydrochloride | WY-45030 | WY-45655 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H27NO2 |
|---|
| Mol. Mass. | 277.4018 |
|---|
| SMILES | COc1ccc(cc1)C(CN(C)C)C1(O)CCCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
