Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeurokinin 3 receptor
LigandBDBM85845
Substrate/Competitorn/a
Ki 82.4±n/a nM
CommentsPDSP_2451
Citation Hay DWGiardina GAGriswold DEUnderwood DCKotzer CJBush BPotts WSandhu PLundberg DFoley JJSchmidt DBMartin LDKilian DLegos JJBarone FCLuttmann MAGrugni MRaveglia LFSarau HM Nonpeptide tachykinin receptor antagonists. III. SB 235375, a low central nervous system-penetrant, potent and selective neurokinin-3 receptor antagonist, inhibits citric acid-induced cough and airways hyper-reactivity in guinea pigs. J Pharmacol Exp Ther 300:314-23 (2002) [PubMed]  Article
More Info.:Get all data from this article
 
Neurokinin 3 receptor
Name:Neurokinin 3 receptor
Synonyms:NK-3 receptor | NK-3R | NKR | Neurokinin B receptor | Neurokinin NK3 | Neuromedin-K receptor | TACR3 | Tachykinin receptor 3
Type:Enzyme Catalytic Domain
Mol. Mass.:51047.50
Organism:mouse
Description:P47937
Residue:452
Sequence:
MASVPTGENWTDGTAGVGSHTGNLSAALGITEWLALQAGNFSSALGLPVTSQAPSQVRAN
LTNQFVQPSWRIALWSLAYGLVVAVAVFGNLIVIWIILAHKRMRTVTNYFLVNLAFSDAS
VAAFNTLVNFIYGVHSEWYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKP
RLSATATKIVIGSIWILAFLLAFPQCLYSKIKVMPGRTLCYVQWPEGPKQHFTYHIIVII
LVYCFPLLIMGVTYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKMMIIVVVTFAICWL
PYHVYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLNKRFRAGFKRAFRW
CPFIQVSSYDELELKTTRFHPTRQSSLYTVSRMESVTVLYDPSEGDPAKSSRKKRAVPRD
PSANGCSHREFKSASTTSSFISSPYTSVDEYS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85845
n/a
NameBDBM85845
Synonyms:N-[(S)-1-Phenylpropyl]-2-phenyl-3-(carboxymethoxy)quinoline-4-carboxamide | SB 235375
TypeSmall organic molecule
Emp. Form.C27H24N2O4
Mol. Mass.440.4905
SMILESCC[C@H](NC(=O)c1c(OCC(O)=O)c(nc2ccccc12)-c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: