Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H1 receptor
LigandBDBM35938
Substrate/Competitorn/a
Ki 2.67±n/a nM
CommentsPDSP_628
Citation Booth RGMoniri NHBakker RAChoksi NYNix WBTimmerman HLeurs R A novel phenylaminotetralin radioligand reveals a subpopulation of histamine H(1) receptors. J Pharmacol Exp Ther 302:328-36 (2002) [PubMed]  Article
More Info.:Get all data from this article
 
Histamine H1 receptor
Name:Histamine H1 receptor
Synonyms:H1R | HH1R | HISTAMINE H1 | HRH1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:55808.72
Organism:Homo sapiens (Human)
Description:Cell pellets from SK-N-MC cells transfected with human H1 receptor were used in binding assay.
Residue:487
Sequence:
MSLPNSSCLLEDKMCEGNKTTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHT
VGNLYIVSLSVADLIVGAVVMPMNILYLLMSKWSLGRPLCLFWLSMDYVASTASIFSVFI
LCIDRYRSVQQPLRYLKYRTKTRASATILGAWFLSFLWVIPILGWNHFMQQTSVRREDKC
ETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCQHRELINRSLPSFSEIKLR
PENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKL
YCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSR
TDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQLGFI
MAAFILCWIPYFIFFMVIAFCKNCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFK
RILHIRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM35938
n/a
NameBDBM35938
Synonyms:1-(p-chlorophenyl)-1-(2-pyridyl)-3-N,N-dimethylpropylamine | 1-(p-chlorophenyl)-1-(2-pyridyl)-3-dimethylaminopropane | 3-(p-chlorophenyl)-3-(2-pyridyl)-N,N-dimethylpropylamine | 5-HT,N-ACETYL | CHEMBL505 | CHLORPHENIRAMINE | CHLORPHENIRAMINE MALEATE | Polaramin | Polaramine | Polaronil | [3H]Chlorphenamine | [3H]Chlorpheniramine | chlorophenylpyridamine | chlorphenamine | clorfeniramina | d-Chlorpheniramine | gamma-(4-chlorophenyl)-N,N-dimethyl-2-pyridinepropanamine | gamma-(4-chlorophenyl)-gamma-(2-pyridyl)propyldimethylamine
Typeradiolabeled ligand
Emp. Form.C16H19ClN2
Mol. Mass.274.788
SMILESCN(C)CCC(c1ccc(Cl)cc1)c1ccccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: