Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H1 receptor
LigandBDBM50017674
Substrate/Competitorn/a
Ki 9.2±n/a nM
CommentsPDSP_673
Citation Booth RGMoniri NHBakker RAChoksi NYNix WBTimmerman HLeurs R A novel phenylaminotetralin radioligand reveals a subpopulation of histamine H(1) receptors. J Pharmacol Exp Ther 302:328-36 (2002) [PubMed]  Article
More Info.:Get all data from this article
 
Histamine H1 receptor
Name:Histamine H1 receptor
Synonyms:HISTAMINE H1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:55641.53
Organism:Cavia porcellus (domestic guinea pig)
Description:Guinea pig cerebellum was used in binding assay.
Residue:488
Sequence:
MSFLPGMTPVTLSNFSWALEDRMLEGNSTTTPTRQLMPLVVVLSSVSLVTVALNLLVLYA
VRSERKLHTVGNLYIVSLSVADLIVGAVVMPMSILYLHRSAWILGRPLCLFWLSMDYVAS
TASIFSVFILCIDRYRSVQQPLRYLRYRTKTRASATILGAWLLSFLWVIPILGWHHFMAP
TSEPREKKCETDFYDVTWFKVMTAIINFYLPTLLMLWFYIRIYKAVRRHCQHRQLINSSL
PSFSEMKLKLENAKVDTRRMGKESPWEDPKRCSKDASGVHTPMPSSQHLVDMPCAAVLSE
DEGGEVGTRQMPMLAVGDGRCCEALNHMHSQLELSGQSRATHSISARPEEWTVVDGQSFP
ITDSDTSTEAAPMGGQPRSGSNSGLDYIKFTWRRLRSHSRQYTSGLHLNRERKAAKQLGC
IMAAFILCWIPYFVFFMVIAFCKSCSNEPVHMFTIWLGYLNSTLNPLIYPLCNENFRKTF
KRILRIPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50017674
n/a
NameBDBM50017674
Synonyms:(2-Benzhydryloxy-ethyl)-dimethyl-amine | 2-(benzhydryloxy)-N,N-dimethylethanamine | 2-(diphenylmethoxy)-N,N-dimethylethanamine | Antitussive | Beldin | Belix | Benadryl | Benylin | CHEMBL657 | DIMENHYDRINATE | DIPHENHYDRAMINE | Dibenil | Diphen | Hydramine | N-[2-(BENZHYDRYLOXY)ETHYL]-N,N-DIMETHYLAMINE | Silphen | US9138431, DIPHENHYDRAMINE (Benadryl) | US9333199, DIPHENHYDRAMINE (Benadryl)
TypeSmall organic molecule
Emp. Form.C17H21NO
Mol. Mass.255.3547
SMILESCN(C)CCOC(c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: