| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Substance-K receptor |
|---|
| Ligand | BDBM50116078 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 0.4±n/a nM |
|---|
| Comments | PDSP_3952 |
|---|
| Citation |  Anthes, JC; Chapman, RW; Richard, C; Eckel, S; Corboz, M; Hey, JA; Fernandez, X; Greenfeder, S; McLeod, R; Sehring, S; Rizzo, C; Crawley, Y; Shih, NY; Piwinski, J; Reichard, G; Ting, P; Carruthers, N; Cuss, FM; Billah, M; Kreutner, W; Egan, RW SCH 206272: a potent, orally active tachykinin NK(1), NK(2), and NK(3) receptor antagonist. Eur J Pharmacol450:191-202 (2002) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Substance-K receptor |
|---|
| Name: | Substance-K receptor |
|---|
| Synonyms: | NK-2 receptor | NK-2R | NK2R | NK2R_HUMAN | NKNAR | Neurokinin 2 receptor | Neurokinin A receptor | Neurokinin NK2 | Neurokinin-2 (NK-2) | Neuromedin-2 receptor (NK-2R) | SKR | TAC2R | TACR2 | Tachykinin receptor 2 | Tachykinin receptor 2 (NK2) | hnk-3 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 44455.78 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P21452 |
|---|
| Residue: | 398 |
|---|
| Sequence: | MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILA
HRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS
IYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATK
CVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLR
HLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSST
MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMA
GDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI
|
|
|
|---|
| BDBM50116078 |
|---|
| n/a |
|---|
| Name | BDBM50116078 |
|---|
| Synonyms: | 3,5-Dichloro-N-[3-(3,4-dichloro-phenyl)-2-methoxyimino-5-(3-methylcarbamoylmethyl-2-oxo-[1,4']bipiperidinyl-1'-yl)-pentyl]-N-ethyl-benzamide | CHEMBL66332 | SCH 206272 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H41Cl4N5O4 |
|---|
| Mol. Mass. | 713.522 |
|---|
| SMILES | CNC(=O)CC1CCCN(C2CCN(CC[C@@H](\C(CN(C)C(=O)c3cc(Cl)cc(Cl)c3)=N\OC)c3ccc(Cl)c(Cl)c3)CC2)C1=O |
|---|
| Structure | 
|
|---|
Search and Browse
