Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADRB2
LigandBDBM50022784
Substrate/Competitorn/a
Ki 1000±n/a nM
CommentsPDSP_3689
Citation Bymaster FPKatner JSNelson DLHemrick-Luecke SKThrelkeld PGHeiligenstein JHMorin SMGehlert DRPerry KW Atomoxetine increases extracellular levels of norepinephrine and dopamine in prefrontal cortex of rat: a potential mechanism for efficacy in attention deficit/hyperactivity disorder. Neuropsychopharmacology 27:699-711 (2002) [PubMed]  Article
More Info.:Get all data from this article
 
ADRB2
Name:Adrenergic receptor beta
Synonyms:Beta-2 adrenergic receptor
Type:PROTEIN
Mol. Mass.:46896.26
Organism:Rattus norvegicus
Description:ChEMBL_38603
Residue:418
Sequence:
MEPHGNDSDFLLAPNGSRAPGHDITQERDEAWVVGMAILMSVIVLAIVFGNVLVITAIAK
FERLQTVTNYFITSLACADLVMGLAVVPFGASHILMKMWNFGNFWCEFWTSIDVLCVTAS
IETLCVIAVDRYVAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATHKQ
AIDCYAKETCCDFFTNQAYAIASSIVSFYVPLVVMVFVYSRVFQVAKRQLQKIDKSEGRF
HAQNLSQVEQDGRSGHGLRSSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIRA
NLIPKEVYILLNWLGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSSSKTYGNGYSSNSNG
RTDYTGEQSAYQLGQEKENELLCEEAPGMEGFVNCQGTVPSLSIDSQGRNCNTNDSPL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50022784
n/a
NameBDBM50022784
Synonyms:(R)-N-methyl-3-phenyl-3-(o-tolyloxy)propan-1-amine | ATOMOXETINE | CHEMBL641 | Methyl-((R)-3-phenyl-3-o-tolyloxy-propyl)-amine | Methyl-(3-phenyl-3-o-tolyloxy-propyl)-amine | Methyl-(3-phenyl-3-o-tolyloxy-propyl)-amine(tomoxetine) | Strattera | Tomoxetine
TypeSmall organic molecule
Emp. Form.C17H21NO
Mol. Mass.255.3547
SMILESCNCCC(Oc1ccccc1C)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: