Reaction Details |
| Report a problem with these data |
Target | L-lactate dehydrogenase A chain |
---|
Ligand | BDBM86138 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Surface Plasmon Resonance (SPR) Assay |
---|
pH | 7.4±0 |
---|
Kd | 8±n/a nM |
---|
Citation | Ward, RA; Brassington, C; Breeze, AL; Caputo, A; Critchlow, S; Davies, G; Goodwin, L; Hassall, G; Greenwood, R; Holdgate, GA; Mrosek, M; Norman, RA; Pearson, S; Tart, J; Tucker, JA; Vogtherr, M; Whittaker, D; Wingfield, J; Winter, J; Hudson, K Design and synthesis of novel lactate dehydrogenase a inhibitors by fragment-based lead generation. J Med Chem55:3285-306 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
L-lactate dehydrogenase A chain |
---|
Name: | L-lactate dehydrogenase A chain |
Synonyms: | L-lactate dehydrogenase A | L-lactate dehydrogenase A chain | LDHA_RAT | Ldh-1 | Ldh1 | Ldha |
Type: | Protein |
Mol. Mass.: | 36456.12 |
Organism: | Rattus norvegicus (Rat) |
Description: | P04642::PDB Codes: 4ajl, 4aj2, 4aje, 4aji, 4ajk, 4ajh, 4ajl, 4al4, 4ajh, 4ajo |
Residue: | 332 |
Sequence: | MAALKDQLIVNLLKEEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKG
EMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFI
IPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGV
HPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYE
VIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGI
SDVVKVTLTPDEEARLKKSADTLWGIQKELQF
|
|
|
BDBM86138 |
---|
n/a |
---|
Name | BDBM86138 |
Synonyms: | LDHA Inhibitor, 34 |
Type | Small organic molecule |
Emp. Form. | C27H31N3O6S2 |
Mol. Mass. | 557.682 |
SMILES | CCCSc1nc2ccc(NC(=O)CCNC(=O)CCCc3ccc(CC(C(O)=O)C(O)=O)cc3)cc2s1 |
Structure |
|