Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetL-lactate dehydrogenase A
LigandBDBM86138
Substrate/Competitorn/a
Meas. Tech.Surface Plasmon Resonance (SPR) Assay
pH7.4±0
Kd 8± 0 nM
Citation Ward RABrassington CBreeze ALCaputo ACritchlow SDavies GGoodwin LHassall GGreenwood RHoldgate GAMrosek MNorman RAPearson STart JTucker JAVogtherr MWhittaker DWingfield JWinter JHudson K Design and synthesis of novel lactate dehydrogenase a inhibitors by fragment-based lead generation. J Med Chem 55:3285-306 (2012) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
L-lactate dehydrogenase A
Name:L-lactate dehydrogenase A
Synonyms:L-lactate dehydrogenase A chain
Type:Protein
Mol. Mass.:36456.12
Organism:Rattus norvegicus (Rat)
Description:P04642::PDB Codes: 4ajl, 4aj2, 4aje, 4aji, 4ajk, 4ajh, 4ajl, 4al4, 4ajh, 4ajo
Residue:332
Sequence:
MAALKDQLIVNLLKEEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKG
EMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFI
IPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGV
HPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYE
VIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGI
SDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM86138
n/a
NameBDBM86138
Synonyms:LDHA Inhibitor, 34
TypeSmall organic molecule
Emp. Form.C27H31N3O6S2
Mol. Mass.557.682
SMILESCCCSc1nc2ccc(NC(=O)CCNC(=O)CCCc3ccc(CC(C(O)=O)C(O)=O)cc3)cc2s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: