| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Pro-FMRFamide-related neuropeptide FF |
|---|
| Ligand | BDBM86139 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 5.2±n/a nM |
|---|
| Comments | PDSP_3002 |
|---|
| Citation |  Engström, M; Brandt, A; Wurster, S; Savola, JM; Panula, P Prolactin releasing peptide has high affinity and efficacy at neuropeptide FF2 receptors. J Pharmacol Exp Ther305:825-32 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Pro-FMRFamide-related neuropeptide FF |
|---|
| Name: | Pro-FMRFamide-related neuropeptide FF |
|---|
| Synonyms: | FMRFamide-related peptides | NPFF_RAT | Npff |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 13156.33 |
|---|
| Organism: | RAT |
|---|
| Description: | NPFF 0 RAT::Q9WVA9 |
|---|
| Residue: | 114 |
|---|
| Sequence: | MDSKWAAVLLLLLLLRNWGHAEEAGSWGEDQVFAEEDKGPHPSQYAHTPDRIQTPGSLMR
VLLQAMERPRRNPAFLFQPQRFGRNAWGPWSKEQLSPQAREFWSLAAPQRFGKK
|
|
|
|---|
| BDBM86139 |
|---|
| n/a |
|---|
| Name | BDBM86139 |
|---|
| Synonyms: | CAS_235433-36-0 | CAS_99566-27-5 | NPSF | NSC_0 | PrRP31 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C54H76N14O10 |
|---|
| Mol. Mass. | 1081.269 |
|---|
| SMILES | [#6]-[#6](-[#6])-[#6]-[#6@H](-[#7]-[#6](=O)-[#6@@H](-[#7])-[#6]-c1ccccc1)-[#6](=O)-[#7]-[#6@@H](-[#6]-c1ccccc1)-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6](-[#7])=O)-[#6](=O)-[#7]-1-[#6]-[#6]-[#6]-[#6@H]-1-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6](-[#7])=O)-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](/[#7])-[#7])-[#6](=O)-[#7]-[#6@@H](-[#6]-c1ccccc1)-[#6](-[#7])=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
