Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 2A
LigandBDBM50130273
Substrate/Competitorn/a
Ki 5.6±n/a nM
CommentsPDSP_1456
Citation Kroeze WKHufeisen SJPopadak BARenock SMSteinberg SErnsberger PJayathilake KMeltzer HYRoth BL H1-histamine receptor affinity predicts short-term weight gain for typical and atypical antipsychotic drugs. Neuropsychopharmacology 28:519-26 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
5-hydroxytryptamine receptor 2A
Name:Dopamine D2 receptor and serotonin 2a receptor
Synonyms:5-HT-2 | 5-HT-2A | 5-HT2A | 5-hydroxytryptamine receptor 2A (5-HT-2A) | 5-hydroxytryptamine receptor 2A (5HT-2A) | 5-hydroxytryptamine receptor 2A (5HT2A) | HTR2 | HTR2A | Serotonin receptor 2A
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:52607.65
Organism:Homo sapiens (Human)
Description:n/a
Residue:471
Sequence:
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50130273
n/a
NameBDBM50130273
Synonyms:2-(4-[3-(2-chloro-10H-phenothiazin-10-yl)propyl]-1-piperazinyl)ethanol | 2-chloro-10-(3-(4-(2-hydroxyethyl)piperazin-1-yl)propyl)phenothiazine | 2-{4-[3-(2-chloro-10H-phenothiazin-10-yl)propyl]piperazin-1-yl}ethanol | 4-[3-(2-chloro-10H-phenothiazin-10-yl)propyl]-1-piperazineethanol | 4-[3-(2-chlorophenothiazin-10-yl)propyl]-1-piperazineethanol | CHEMBL567 | Chlorpiprazine | PERPHENAZINE | Perfenazine | Perphenazin | Trilafon | gamma-(4-(beta-hydroxyethyl)piperazin-1-yl)propyl-2-chlorophenothiazine
TypeSmall organic molecule
Emp. Form.C21H26ClN3OS
Mol. Mass.403.969
SMILESOCCN1CCN(CCCN2c3ccccc3Sc3ccc(Cl)cc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: