Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHRH3
LigandBDBM86188
Substrate/Competitorn/a
Ki 1.9±n/a nM
CommentsPDSP_3074
Citation McLeod RLRizzo CAWest REAslanian RMcCormick KBryant MHsieh YKorfmacher WMingo GGVarty LWilliams SMShih NYEgan RWHey JA Pharmacological characterization of the novel histamine H3-receptor antagonist N-(3,5-dichlorophenyl)-N'-[[4-(1H-imidazol-4-ylmethyl)phenyl]-methyl]-urea (SCH 79687). J Pharmacol Exp Ther 305:1037-44 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
HRH3
Name:HRH3
Synonyms:HISTAMINE H3 | Hrh3 protein
Type:Enzyme Catalytic Domain
Mol. Mass.:37860.96
Organism:RAT
Description:Q5PPG3
Residue:344
Sequence:
MERAPPDGLMNASGTLAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCAS
SVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGREAG
PEPPPDAQPSPPPAPPSCWGCWPKGHGEAMPLHRGSKPSASSASLEKRMKMVSQSITQRF
RLSRDKKVAKSLAIIVSIFGLCWAPYTLLMIIRAACHGRCIPDY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM86188
n/a
NameBDBM86188
Synonyms:CHEMBL366977 | SCH 79687
TypeSmall organic molecule
Emp. Form.C18H16Cl2N4O
Mol. Mass.375.252
SMILESClc1cc(Cl)cc(NC(=O)NCc2ccc(Cc3cnc[nH]3)cc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: