Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholinergic, Nicotinic Alpha3Beta2
LigandBDBM50004108
Substrate/Competitorn/a
Ki 187±n/a nM
CommentsPDSP_1311
Citation Cohen CBergis OEGalli FLochead AWJegham SBiton BLeonardon JAvenet PSgard FBesnard FGraham DCoste AOblin ACuret OVoltz CGardes ACaille DPerrault GGeorge PSoubrie PScatton B SSR591813, a novel selective and partial alpha4beta2 nicotinic receptor agonist with potential as an aid to smoking cessation. J Pharmacol Exp Ther 306:407-20 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
Cholinergic, Nicotinic Alpha3Beta2
Name:Integrin alpha-5/Neuronal acetylcholine receptor subunit alpha-3/Neuronal acetylcholine receptor subunit beta-2/Neuronal acetylcholine receptor subunit beta-4
Synonyms:Cholinergic, Nicotinic Alpha3Beta4 | Cholinergic, Nicotinic Alpha3Beta4x | Neuronal acetylcholine receptor protein alpha-3 subunit | Neuronal acetylcholine receptor subunit alpha-3 | Nicotinic acetylcholine receptor alpha6/alpha3/beta4 | nicotinic central
Type:Enzyme Catalytic Domain
Mol. Mass.:57479.03
Organism:Homo sapiens (Human)
Description:Cholinergic, Nicotinic Alpha3Beta2 0 HUMAN::P32297
Residue:505
Sequence:
MGSGPLSLPLALSPPRLLLLLLLSLLPVARASEAEHRLFERLFEDYNEIIRPVANVSDPV
IIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPD
IVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSW
SYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL
PLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLV
IPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPT
SNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLT
RSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFL
WVFTLVCILGTAGLFLQPLMAREDA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004108
n/a
NameBDBM50004108
Synonyms:(+-)-nicotine | (R,S)-nicotine | (RS)-nicotine | 3-(1-methylpyrrolidin-2-yl)pyridine | CHEMBL440464 | Nicotin | Nicotine-(+) | Nikotin | US8609708, 54 Nicotine | US9284322, Nicotine | nicotine
TypeSmall organic molecule
Emp. Form.C10H14N2
Mol. Mass.162.2316
SMILESCN1CCCC1c1cccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: