Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 4
LigandBDBM14773
Substrate/Competitorn/a
Ki 200±n/a nM
CommentsPDSP_3036
Citation Zhao YZhang HTO'Donnell JM Inhibitor binding to type 4 phosphodiesterase (PDE4) assessed using [3H]piclamilast and [3H]rolipram. J Pharmacol Exp Ther 305:565-72 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
Phosphodiesterase 4
Name:Phosphodiesterase 4
Synonyms:Phosphodiesterase 4B | cAMP-specific 3'',5''-cyclic phosphodiesterase 4B
Type:Enzyme Catalytic Domain
Mol. Mass.:83349.50
Organism:RAT
Description:Phosphodiesterase 4 0 RAT::P14646
Residue:736
Sequence:
MKKSRSVMAVTADDNLKDYFECSLSKSYSSSSYTLGIDLWRGRRCCSGNLQLPPLSQRQS
ERARTPEGDGISRPTTLPLTTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSSGLVL
HAAFPGHSQRRESFLYRSDSDYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRIVR
NNFTLLTNLHGAPNKRSPAASQAPVTRVSLQEESYQKLAMETLEELDWCLDQLETIQTYR
SVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKK
KQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSH
NRPLTCIMYAIFQERDLLKTFKISSDTFVTYMMTLEDHYHSDVAYHNSLHAADVAQSTHV
LLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHL
AVGFKLLQEEHCDIFQNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTS
SGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEI
SPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQSP
SPPLDERSRDCQGLMEKFQFELTLEEEDSEGPEKEGEGPNYFSSTKTLCVIDPENRDSLE
ETDIDIATEDKSLIDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14773
n/a
NameBDBM14773
Synonyms:4-cyano-4-(3-cyclopentyloxy-4-methoxy-phenyl)cyclohexane-1-carboxylic acid | 4-cyano-4-[3-(cyclopentyloxy)-4-methoxyphenyl]cyclohexane-1-carboxylic acid | Ariflo | Cilomilast | SB207499
TypeSmall organic molecule
Emp. Form.C20H25NO4
Mol. Mass.343.4168
SMILESCOc1ccc(cc1OC1CCCC1)C1(CCC(CC1)C(O)=O)C#N |(1.4,-2.1,;1.4,-.56,;.07,.21,;-1.27,-.56,;-2.6,.21,;-2.6,1.75,;-1.27,2.52,;.07,1.75,;1.4,2.52,;1.4,4.06,;2.65,4.96,;2.17,6.43,;.63,6.43,;.15,4.96,;-3.93,2.52,;-4.44,3.97,;-5.95,4.26,;-6.96,3.1,;-6.46,1.65,;-4.94,1.35,;-8.47,3.39,;-9.48,2.23,;-8.97,4.85,;-3.16,3.85,;-2.39,5.18,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: