Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 4
LigandBDBM15296
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_3040
Citation Zhao YZhang HTO'Donnell JM Inhibitor binding to type 4 phosphodiesterase (PDE4) assessed using [3H]piclamilast and [3H]rolipram. J Pharmacol Exp Ther 305:565-72 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
Phosphodiesterase 4
Name:Phosphodiesterase 4
Synonyms:Phosphodiesterase 4B | cAMP-specific 3'',5''-cyclic phosphodiesterase 4B
Type:Enzyme Catalytic Domain
Mol. Mass.:83349.50
Organism:RAT
Description:Phosphodiesterase 4 0 RAT::P14646
Residue:736
Sequence:
MKKSRSVMAVTADDNLKDYFECSLSKSYSSSSYTLGIDLWRGRRCCSGNLQLPPLSQRQS
ERARTPEGDGISRPTTLPLTTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSSGLVL
HAAFPGHSQRRESFLYRSDSDYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRIVR
NNFTLLTNLHGAPNKRSPAASQAPVTRVSLQEESYQKLAMETLEELDWCLDQLETIQTYR
SVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKK
KQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSH
NRPLTCIMYAIFQERDLLKTFKISSDTFVTYMMTLEDHYHSDVAYHNSLHAADVAQSTHV
LLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHL
AVGFKLLQEEHCDIFQNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTS
SGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEI
SPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQSP
SPPLDERSRDCQGLMEKFQFELTLEEEDSEGPEKEGEGPNYFSSTKTLCVIDPENRDSLE
ETDIDIATEDKSLIDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM15296
n/a
NameBDBM15296
Synonyms:6-methyl-2-oxo-5-(pyridin-4-yl)-1,2-dihydropyridine-3-carbonitrile | 6-methyl-2-oxo-5-pyridin-4-yl-1H-pyridine-3-carbonitrile | CHEMBL189 | Milrinone | Primacor | US9242982, Milrinone | US9249139, Milrinone
TypeSmall organic molecule
Emp. Form.C12H9N3O
Mol. Mass.211.2194
SMILESCc1[nH]c(=O)c(cc1-c1ccncc1)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: