Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 4
LigandBDBM50010981
Substrate/Competitorn/a
Ki 189.1±n/a nM
CommentsPDSP_3034
Citation Zhao YZhang HTO'Donnell JM Inhibitor binding to type 4 phosphodiesterase (PDE4) assessed using [3H]piclamilast and [3H]rolipram. J Pharmacol Exp Ther 305:565-72 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
Phosphodiesterase 4
Name:Phosphodiesterase 4
Synonyms:Phosphodiesterase 4B | cAMP-specific 3'',5''-cyclic phosphodiesterase 4B
Type:Enzyme Catalytic Domain
Mol. Mass.:83349.50
Organism:RAT
Description:Phosphodiesterase 4 0 RAT::P14646
Residue:736
Sequence:
MKKSRSVMAVTADDNLKDYFECSLSKSYSSSSYTLGIDLWRGRRCCSGNLQLPPLSQRQS
ERARTPEGDGISRPTTLPLTTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSSGLVL
HAAFPGHSQRRESFLYRSDSDYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRIVR
NNFTLLTNLHGAPNKRSPAASQAPVTRVSLQEESYQKLAMETLEELDWCLDQLETIQTYR
SVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKK
KQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSH
NRPLTCIMYAIFQERDLLKTFKISSDTFVTYMMTLEDHYHSDVAYHNSLHAADVAQSTHV
LLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHL
AVGFKLLQEEHCDIFQNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTS
SGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEI
SPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQSP
SPPLDERSRDCQGLMEKFQFELTLEEEDSEGPEKEGEGPNYFSSTKTLCVIDPENRDSLE
ETDIDIATEDKSLIDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010981
n/a
NameBDBM50010981
Synonyms:(Ro 20-1724)4-(3-Butoxy-4-methoxy-benzyl)-imidazolidin-2-one | 4-(3-Butoxy-4-methoxy-benzyl)-imidazolidin-2-one | 4-(3-Butoxy-4-methoxy-benzyl)-imidazolidin-2-one(Ro 20-1724) | 4-(3-Butyl-4-methoxy-benzyl)-imidazolidin-2-one | CHEMBL18701 | RO 20-1724 | Ro-20-1724
TypeSmall organic molecule
Emp. Form.C15H22N2O3
Mol. Mass.278.3468
SMILESCCCCOc1cc(CC2CNC(=O)N2)ccc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: