| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gamma-aminobutyric acid receptor subunit alpha-1 |
|---|
| Ligand | BDBM50133817 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | >10000±n/a nM |
|---|
| Comments | PDSP_7569 |
|---|
| Citation |  Valenzano, KJ; Grant, ER; Wu, G; Hachicha, M; Schmid, L; Tafesse, L; Sun, Q; Rotshteyn, Y; Francis, J; Limberis, J; Malik, S; Whittemore, ER; Hodges, D N-(4-tertiarybutylphenyl)-4-(3-chloropyridin-2-yl)tetrahydropyrazine -1(2H)-carbox-amide (BCTC), a novel, orally effective vanilloid receptor 1 antagonist with analgesic properties: I. in vitro characterization and pharmacokinetic properties. J Pharmacol Exp Ther306:377-86 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Gamma-aminobutyric acid receptor subunit alpha-1 |
|---|
| Name: | Gamma-aminobutyric acid receptor subunit alpha-1 |
|---|
| Synonyms: | Benzodiazepine central | Benzodiazepine receptors | GABA A Benzodiazepine | GABA A Benzodiazepine Type I | GABA A Benzodiazepine Type II | GABA A Benzodiazepine Type IIL | GABA A Benzodiazepine Type IIM | GABA A Benzodiazepine omega1 | GABA A Benzodiazepine omega2 | GABA A Benzodiazepine omega5 | GABA A alpha1 | GABA A anti-Alpha1 | GABA receptor alpha-1 subunit | GABA, Chloride, TBOB | GABA-PICROTOXIN | GBRA1_RAT | Gabra-1 | Gabra1 | TBPS |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 51770.21 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | P62813 |
|---|
| Residue: | 455 |
|---|
| Sequence: | MKKSRGLSDYLWAWTLILSTLSGRSYGQPSQDELKDNTTVFTRILDRLLDGYDNRLRPGL
GERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKI
WTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACP
LKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMT
THFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISAR
NSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPL
IKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDR
LSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
|
|
|
|---|
| BDBM50133817 |
|---|
| n/a |
|---|
| Name | BDBM50133817 |
|---|
| Synonyms: | 4-(3-Chloro-pyridin-2-yl)-piperazine-1-carboxylic acid (4-tert-butyl-phenyl)-amide | BCTC | CHEMBL441472 | N-(4-tert-butylphenyl)-4-(3-chloropyridin-2-yl)piperazine-1-carboxamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H25ClN4O |
|---|
| Mol. Mass. | 372.892 |
|---|
| SMILES | CC(C)(C)c1ccc(NC(=O)N2CCN(CC2)c2ncccc2Cl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
