Reaction Details |
| Report a problem with these data |
Target | Melatonin receptor type 1A |
---|
Ligand | BDBM50133817 |
---|
Substrate/Competitor | n/a |
---|
Ki | >10000±n/a nM |
---|
Comments | PDSP_7569 |
---|
Citation | Valenzano, KJ; Grant, ER; Wu, G; Hachicha, M; Schmid, L; Tafesse, L; Sun, Q; Rotshteyn, Y; Francis, J; Limberis, J; Malik, S; Whittemore, ER; Hodges, D N-(4-tertiarybutylphenyl)-4-(3-chloropyridin-2-yl)tetrahydropyrazine -1(2H)-carbox-amide (BCTC), a novel, orally effective vanilloid receptor 1 antagonist with analgesic properties: I. in vitro characterization and pharmacokinetic properties. J Pharmacol Exp Ther306:377-86 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Melatonin receptor type 1A |
---|
Name: | Melatonin receptor type 1A |
Synonyms: | MTR1A_RAT | Melatonin | Melatonin receptor type 1A | Mtnr1a |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 18222.65 |
Organism: | RAT |
Description: | Melatonin 0 RAT::P49218 |
Residue: | 156 |
Sequence: | CYICHSLKYDRIYSNKNSLCYVFLIWTLTLIAIMPNLQTGTLQYDPRIYSCTFTQSVSSA
YTIALVVFHFVVPMIIVTFCYLRIWILVLQVRRRVKPDSKPKLKPQDFRNFVTMFVVFVL
FALCWAPLNFIGLIVASDPATMAPRIPEWLFVASYY
|
|
|
BDBM50133817 |
---|
n/a |
---|
Name | BDBM50133817 |
Synonyms: | 4-(3-Chloro-pyridin-2-yl)-piperazine-1-carboxylic acid (4-tert-butyl-phenyl)-amide | BCTC | CHEMBL441472 | N-(4-tert-butylphenyl)-4-(3-chloropyridin-2-yl)piperazine-1-carboxamide |
Type | Small organic molecule |
Emp. Form. | C20H25ClN4O |
Mol. Mass. | 372.892 |
SMILES | CC(C)(C)c1ccc(NC(=O)N2CCN(CC2)c2ncccc2Cl)cc1 |
Structure |
|