Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRenal Outer Medullary Potassium (ROMK)
LigandBDBM50133817
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_7569
Citation Valenzano KJGrant ERWu GHachicha MSchmid LTafesse LSun QRotshteyn YFrancis JLimberis JMalik SWhittemore ERHodges D N-(4-tertiarybutylphenyl)-4-(3-chloropyridin-2-yl)tetrahydropyrazine -1(2H)-carbox-amide (BCTC), a novel, orally effective vanilloid receptor 1 antagonist with analgesic properties: I. in vitro characterization and pharmacokinetic properties. J Pharmacol Exp Ther 306:377-86 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
Renal Outer Medullary Potassium (ROMK)
Name:Renal Outer Medullary Potassium (ROMK)
Synonyms:ATP-regulated potassium channel ROM-K | ATP-sensitive inward rectifier potassium channel 1 | Inward rectifier K(+) channel Kir1.1 | KAB-1 | Kcnj1 | Potassium channel (ATP modulatory) | Potassium channel, inwardly rectifying subfamily J member 1 | Renal Outer Medullary Potassium (ROMK1) | Romk1 | The Renal Outer Medullary Potassium (ROMK) channel (Kir1.1)
Type:Enzyme
Mol. Mass.:44976.27
Organism:Rattus norvegicus (Rat)
Description:P35560
Residue:391
Sequence:
MGASERSVFRVLIRALTERMFKHLRRWFITHIFGRSRQRARLVSKEGRCNIEFGNVDAQS
RFIFFVDIWTTVLDLKWRYKMTVFITAFLGSWFLFGLLWYVVAYVHKDLPEFYPPDNRTP
CVENINGMTSAFLFSLETQVTIGYGFRFVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTITPEGE
TIILDQTNINFVVDAGNENLFFISPLTIYHIIDHNSPFFHMAAETLSQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFVPIVSKTKEGKYRVDFHNFGKTVEVETPHCAMCLY
NEKDARARMKRGYDNPNFVLSEVDETDDTQM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50133817
n/a
NameBDBM50133817
Synonyms:4-(3-Chloro-pyridin-2-yl)-piperazine-1-carboxylic acid (4-tert-butyl-phenyl)-amide | BCTC | CHEMBL441472 | N-(4-tert-butylphenyl)-4-(3-chloropyridin-2-yl)piperazine-1-carboxamide
TypeSmall organic molecule
Emp. Form.C20H25ClN4O
Mol. Mass.372.892
SMILESCC(C)(C)c1ccc(NC(=O)N2CCN(CC2)c2ncccc2Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: