Reaction Details |
 | Report a problem with these data |
Target | Renal Outer Medullary Potassium (ROMK) |
---|
Ligand | BDBM50133817 |
---|
Substrate/Competitor | n/a |
---|
Ki | >10000±n/a nM |
---|
Comments | PDSP_7569 |
---|
Citation | Valenzano KJ; Grant ER; Wu G; Hachicha M; Schmid L; Tafesse L; Sun Q; Rotshteyn Y; Francis J; Limberis J; Malik S; Whittemore ER; Hodges D N-(4-tertiarybutylphenyl)-4-(3-chloropyridin-2-yl)tetrahydropyrazine -1(2H)-carbox-amide (BCTC), a novel, orally effective vanilloid receptor 1 antagonist with analgesic properties: I. in vitro characterization and pharmacokinetic properties. J Pharmacol Exp Ther 306:377-86 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Renal Outer Medullary Potassium (ROMK) |
---|
Name: | Renal Outer Medullary Potassium (ROMK) |
Synonyms: | ATP-regulated potassium channel ROM-K | ATP-sensitive inward rectifier potassium channel 1 | Inward rectifier K(+) channel Kir1.1 | KAB-1 | Kcnj1 | Potassium channel (ATP modulatory) | Potassium channel, inwardly rectifying subfamily J member 1 | Renal Outer Medullary Potassium (ROMK1) | Romk1 | The Renal Outer Medullary Potassium (ROMK) channel (Kir1.1) |
Type: | Enzyme |
Mol. Mass.: | 44976.27 |
Organism: | Rattus norvegicus (Rat) |
Description: | P35560 |
Residue: | 391 |
Sequence: | MGASERSVFRVLIRALTERMFKHLRRWFITHIFGRSRQRARLVSKEGRCNIEFGNVDAQS
RFIFFVDIWTTVLDLKWRYKMTVFITAFLGSWFLFGLLWYVVAYVHKDLPEFYPPDNRTP
CVENINGMTSAFLFSLETQVTIGYGFRFVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTITPEGE
TIILDQTNINFVVDAGNENLFFISPLTIYHIIDHNSPFFHMAAETLSQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFVPIVSKTKEGKYRVDFHNFGKTVEVETPHCAMCLY
NEKDARARMKRGYDNPNFVLSEVDETDDTQM
|
|
|
BDBM50133817 |
---|
n/a |
---|
Name | BDBM50133817 |
Synonyms: | 4-(3-Chloro-pyridin-2-yl)-piperazine-1-carboxylic acid (4-tert-butyl-phenyl)-amide | BCTC | CHEMBL441472 | N-(4-tert-butylphenyl)-4-(3-chloropyridin-2-yl)piperazine-1-carboxamide |
Type | Small organic molecule |
Emp. Form. | C20H25ClN4O |
Mol. Mass. | 372.892 |
SMILES | CC(C)(C)c1ccc(NC(=O)N2CCN(CC2)c2ncccc2Cl)cc1 |
Structure |
|